DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31038 and fam89a

DIOPT Version :9

Sequence 1:NP_733326.1 Gene:CG31038 / 43535 FlyBaseID:FBgn0051038 Length:730 Species:Drosophila melanogaster
Sequence 2:NP_001373193.1 Gene:fam89a / 568145 ZFINID:ZDB-GENE-111019-1 Length:175 Species:Danio rerio


Alignment Length:237 Identity:73/237 - (30%)
Similarity:92/237 - (38%) Gaps:93/237 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   477 NGKRGNSAC--------ELPPLPKSLIGFNKLLCSDSGLLSDVEGNNNSSDGSRKPNDNLAVE-- 531
            |.|.||.|.        .||||||||          ||||       |||.||.:..:.:.|:  
Zfish     2 NDKVGNGAAGGVLACIEGLPPLPKSL----------SGLL-------NSSGGSWRDMERMYVKKT 49

  Fly   532 -TQDTKEHATDKSLPSSPNGNTSIPPMLVAKSEAKSPSLSAKGNPQAVEAGSTLDAQIATLRKEM 595
             .||      |.|     .|..:...:|..|.                   :.|||.:|.|||||
Zfish    50 MIQD------DLS-----RGRNNADNLLANKP-------------------ANLDAALALLRKEM 84

  Fly   596 NGLRQLDLSLLSQLWVLNESIQEFRALIED------------QENE--DEDDEVEVEVGNELDEE 646
            .||||.|:|||.|||.|:|||||::...:|            .||.  |||:|...|        
Zfish    85 VGLRQQDMSLLCQLWSLHESIQEYKGSCQDLSAVSSADGPYGMENGYFDEDEEYYTE-------- 141

  Fly   647 GNSRVSSSIESVRLEGGADGTSKHLGTIPKVITTQPKVLRDS 688
                  |::.......|.|       |.||..|::...:.||
Zfish   142 ------SAVTPAETPDGND-------TSPKNGTSKDSWIHDS 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31038NP_733326.1 PTZ00459 <447..>587 CDD:185638 32/120 (27%)
fam89aNP_001373193.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 57 1.000 Domainoid score I10836
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004047
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR46949
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.100

Return to query results.
Submit another query.