DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31038 and FAM89B

DIOPT Version :9

Sequence 1:NP_733326.1 Gene:CG31038 / 43535 FlyBaseID:FBgn0051038 Length:730 Species:Drosophila melanogaster
Sequence 2:NP_001092255.1 Gene:FAM89B / 23625 HGNCID:16708 Length:189 Species:Homo sapiens


Alignment Length:242 Identity:71/242 - (29%)
Similarity:95/242 - (39%) Gaps:93/242 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   478 GKRGNSACELPPLPKSLIGFNKLLCSDSGLLSDVEGNNNSSDGSRKPNDNLAVETQDTKEHATDK 542
            |..|.:...|||||:.|          ||||       |:|.||.:..:.  |.:|.::.|....
Human    11 GGAGCALAGLPPLPRGL----------SGLL-------NASGGSWRELER--VYSQRSRIHDELS 56

  Fly   543 SLPSSPNGNTSIPPMLVAKSEAKSPSLSAKGNPQAVEAGSTLDAQIATLRKEMNGLRQLDLSLLS 607
            ....:|:|     |...|.:....|   |.|..:.|    .||:.:|.|||||.||||||:|||.
Human    57 RAARAPDG-----PRHAAGAANAGP---AAGPRRPV----NLDSALAALRKEMVGLRQLDMSLLC 109

  Fly   608 QLWVLNESIQEFRALIED----QENEDEDDEVEVEVGNELDEEGNSRVSSSIESVRLEGGADGTS 668
            |||.|.||||:::.|.:|    |:                       :|||:.|           
Human   110 QLWGLYESIQDYKHLCQDLSFCQD-----------------------LSSSLHS----------- 140

  Fly   669 KHLGTIPKVITTQPKVLRDSL----ATASKDQKPVPRMRSAPPPPPP 711
                              ||.    |..|.|::|..  .|.||.|||
Human   141 ------------------DSSYPPDAGLSDDEEPPD--ASLPPDPPP 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31038NP_733326.1 PTZ00459 <447..>587 CDD:185638 29/108 (27%)
FAM89BNP_001092255.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 54..83 7/36 (19%)
LRR. /evidence=ECO:0000250|UniProtKB:Q566R4 86..114 20/27 (74%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 141..175 12/29 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141207
Domainoid 1 1.000 56 1.000 Domainoid score I11009
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004047
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR46949
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.