DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31038 and fam89b

DIOPT Version :9

Sequence 1:NP_733326.1 Gene:CG31038 / 43535 FlyBaseID:FBgn0051038 Length:730 Species:Drosophila melanogaster
Sequence 2:XP_001921419.1 Gene:fam89b / 100151239 ZFINID:ZDB-GENE-091204-269 Length:174 Species:Danio rerio


Alignment Length:189 Identity:58/189 - (30%)
Similarity:76/189 - (40%) Gaps:84/189 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly   483 SACE---LPPLPKSLIGFNKLLCSDSGLLSDVEGNNNSSDGSRKPNDNL-----AVETQDTKEHA 539
            |.|.   ||||||.|          ||:|       |||.||.:..:.:     .::...:|...
Zfish    15 SVCPVEGLPPLPKGL----------SGIL-------NSSGGSWRDIEKVYSKRTRIQADISKSRV 62

  Fly   540 TD---KSLPSSPNGNTSIPPMLVAKSEAKSPSLSAKGNPQAVEAGSTLDAQIATLRKEMNGLRQL 601
            :|   :|.|:|                                    |||.:|.|||:|.|||||
Zfish    63 SDCLERSKPAS------------------------------------LDAALAVLRKDMVGLRQL 91

  Fly   602 DLSLLSQLWVLNESIQEFRALIED-------------------QENEDEDDEVEVEVGN 641
            |:|||.|||.|.|||||::...:|                   :|.|||||. |.|.|:
Zfish    92 DMSLLCQLWSLYESIQEYKGAFQDISSSLCESSFNTENGYSEEEEEEDEDDH-EAERGD 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31038NP_733326.1 PTZ00459 <447..>587 CDD:185638 24/114 (21%)
fam89bXP_001921419.1 LURAP 62..>125 CDD:317287 31/98 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170574118
Domainoid 1 1.000 57 1.000 Domainoid score I10836
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004047
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR46949
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
55.030

Return to query results.
Submit another query.