DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zip99C and Slc39a5

DIOPT Version :9

Sequence 1:NP_001189313.1 Gene:Zip99C / 43533 FlyBaseID:FBgn0039714 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001129709.1 Gene:Slc39a5 / 72002 MGIID:1919336 Length:535 Species:Mus musculus


Alignment Length:306 Identity:98/306 - (32%)
Similarity:143/306 - (46%) Gaps:43/306 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 KLLRVLLSF----AVGGLLGDVFLHLLPEAWEGDNQDPS--SHPSLRSGLWVLSGILIFTIVEKI 133
            :|||.:|.|    |||.|.||..|||||.|..|.:..||  |...|..||.||.|:.:..::|..
Mouse   238 RLLRPVLGFLGALAVGTLCGDALLHLLPHAQGGRHTGPSEQSEEDLGPGLSVLGGLFLLFMLENT 302

  Fly   134 FSGYASADEENPQPKCVEIANCLLRRHGGQLPEGETSESCG-------GACDIEDVGKVCFLREQ 191
            .   ........:|:|     |..:|..|: |..:..:..|       .|.:.|..|:    ||.
Mouse   303 L---GLVRHRGLRPRC-----CRNKRDLGE-PNPDPEDGSGMVLRPLQAASEPEVQGQ----REN 354

  Fly   192 EQKS----------KERKEQPKKVAGYLNLLANSIDNFTHGLAVAGSFLVSFRHGILATFAILLH 246
            .|.|          ...:.:...:| ::.||.:.:.|.|.|||:..:|...|..|:..|.|:..|
Mouse   355 RQSSPSLAPPGHQGHSHEHRGGSIA-WMVLLGDCLHNLTDGLALGAAFSDGFSSGLSTTLAVFCH 418

  Fly   247 EIPHEVGDFAILLRSGFSRWDAARAQLLTAGAGLLGALVAIGGSGVTSAMEARTSWIMPFTAGGF 311
            |:|||:||||:||:.|.|........|::...||.||.:   |.|::......|.|:...|||.|
Mouse   419 ELPHELGDFAMLLQEGLSFRKLLLLSLVSGALGLGGAAL---GVGLSLGPVPLTPWVFGTTAGVF 480

  Fly   312 LHIALVTVLPDLLKEEERK---ESIKQLLALVFGIALMAVMTMLFE 354
            |::|||.:||.||:..|..   ..:.|.|.|:.|.:||..:.:|.|
Mouse   481 LYVALVDMLPTLLRPPEPLPVFHVLLQGLGLLLGGSLMFTIALLEE 526

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zip99CNP_001189313.1 Zip 34..350 CDD:280666 96/300 (32%)
Slc39a5NP_001129709.1 Zip 243..499 CDD:308248 87/272 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 316..373 12/61 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0428
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D657777at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.