DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zip99C and Slc39a11

DIOPT Version :9

Sequence 1:NP_001189313.1 Gene:Zip99C / 43533 FlyBaseID:FBgn0039714 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001349866.1 Gene:Slc39a11 / 69806 MGIID:1917056 Length:416 Species:Mus musculus


Alignment Length:357 Identity:63/357 - (17%)
Similarity:121/357 - (33%) Gaps:98/357 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 YSNLMDQYMPEYFKSFEYTPWVFSLLGSVVIGLSGIFPLIIIPTEEKMAKEGYKDPADSKLLRVL 80
            ||:::...:..:|      .|..:..|:.::        .|..:.::...:|            .
Mouse    79 YSSVVQALLGTFF------TWAMTAAGAALV--------FIFSSGQRRILDG------------S 117

  Fly    81 LSFAVGGLLGDVFLHLLPEAWEGDNQDPSSHPSLRSGLW-------VLSGILI---FTIVEKIFS 135
            |.||.|.:|...:..||.         |:...:..||.:       |..|..:   |..:..:..
Mouse   118 LGFAAGVMLAASYWSLLA---------PAVEMATSSGGFGAFAFFPVAVGFTLGAAFVYLADLLM 173

  Fly   136 GYASADEENPQPKCVEIANCLLRRHGGQ------LPEGETSESCGGACDIEDVGKVCFLREQEQK 194
            .:..|.|:......:.:...|:::...:      .||.|.|...|....:.|       :.:..:
Mouse   174 PHLGATEDPQTALALNLDPALMKKSDPRDPTSLLFPESELSIRIGSTGLLSD-------KRENGE 231

  Fly   195 SKERKE---------------------QP-----KKVAGYLNLLANSIDNFTHGLAVAGSF---- 229
            ..:||:                     ||     :::|  |.:||.:|.|...||||...|    
Mouse   232 VYQRKKVAATDLAEGVAPSGSMHGSSGQPGGSSWRRIA--LLILAITIHNIPEGLAVGVGFGAVE 294

  Fly   230 ---LVSFRHGILATFAILLHEIPHEVGDFAILLRSGFSRWDAA-RAQLLTAGAGLLGALVAIGGS 290
               ..:|.........|.:...|..:.....|..:|||.|.|. ..||    :|::..|..:.|:
Mouse   295 KTASATFESARNLAIGIGIQNFPEGLAVSLPLRGAGFSTWKAFWYGQL----SGMVEPLAGVFGA 355

  Fly   291 GVTSAMEARTSWIMPFTAGGFLHIALVTVLPD 322
            ......|....:.:.|.||..:::.:..::|:
Mouse   356 FAVVLAEPILPYALAFAAGAMVYVVMDDIIPE 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zip99CNP_001189313.1 Zip 34..350 CDD:280666 60/339 (18%)
Slc39a11NP_001349866.1 ZupT 80..416 CDD:223505 62/356 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0428
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.