DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zip99C and SLC39A4

DIOPT Version :9

Sequence 1:NP_001189313.1 Gene:Zip99C / 43533 FlyBaseID:FBgn0039714 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_570901.3 Gene:SLC39A4 / 55630 HGNCID:17129 Length:647 Species:Homo sapiens


Alignment Length:350 Identity:98/350 - (28%)
Similarity:156/350 - (44%) Gaps:74/350 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 WVFSLLGSVVIGLSGIFPLIIIPTEEKMAKEGYKDPADSKLLRVLLSFAVGGLLGDVFLHLLPE- 99
            :::..|.:::|.|..:|.|:::..........|       :|:..||.|||.:.||..|||.|: 
Human   327 YLYGSLATLLICLCAVFGLLLLTCTGCRGVTHY-------ILQTFLSLAVGAVTGDAVLHLTPKV 384

  Fly   100 ------AWEGDNQDPSSHPSLRSGLW----VLSGILIFTIVEKIFSGYASADEENPQPKCVEIAN 154
                  :.||.:..|:         |    :|:|:..|.:.|.:|:.....|     |:.:|...
Human   385 LGLHTHSEEGLSPQPT---------WRLLAMLAGLYAFFLFENLFNLLLPRD-----PEDLEDGP 435

  Fly   155 C--LLRRHGG-------QLPEGETSESC----GGACDIEDVGKVCFLREQEQKSKERKEQPKKVA 206
            |  ....|||       ||...|..:..    |...|:          ..|:..:....:|::::
Human   436 CGHSSHSHGGHSHGVSLQLAPSELRQPKPPHEGSRADL----------VAEESPELLNPEPRRLS 490

  Fly   207 GYLNL------LANSIDNFTHGLAVAGSFLVSFRHGILATFAILLHEIPHEVGDFAILLRSGFSR 265
            ..|.|      |.:::.||..||||..:|..|::.|:..:.|:..||:|||:||||.||.:|.|.
Human   491 PELRLLPYMITLGDAVHNFADGLAVGAAFASSWKTGLATSLAVFCHELPHELGDFAALLHAGLSV 555

  Fly   266 WDAA---RAQLLTAGAGLLGALVAIGGSGVTSAMEARTSWIMPFTAGGFLHIALVTVLPDLLKEE 327
            ..|.   .|..|||.|||..||..    ||:...||   ||:....|.||::||..:||.:||..
Human   556 RQALLLNLASALTAFAGLYVALAV----GVSEESEA---WILAVATGLFLYVALCDMLPAMLKVR 613

  Fly   328 ERKESIKQLLALVFGIALMAVMTML 352
            :.:   ..||.|:..:.|:...|:|
Human   614 DPR---PWLLFLLHNVGLLGGWTVL 635

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zip99CNP_001189313.1 Zip 34..350 CDD:280666 96/346 (28%)
SLC39A4NP_570901.3 ZIP4_domain 46..196 CDD:375719
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 236..255
Zip 328..638 CDD:308248 97/348 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 458..486 4/37 (11%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0428
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D657777at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.