DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zip99C and slc39a11

DIOPT Version :9

Sequence 1:NP_001189313.1 Gene:Zip99C / 43533 FlyBaseID:FBgn0039714 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001016721.1 Gene:slc39a11 / 549475 XenbaseID:XB-GENE-1003667 Length:336 Species:Xenopus tropicalis


Alignment Length:323 Identity:69/323 - (21%)
Similarity:119/323 - (36%) Gaps:53/323 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 YTPWVFSLLGSVVI-GL--SGIFPLIIIPTEEKMAKEGYKDPADSKLLRVLLSFAVGGLLGDVFL 94
            |:|.:.||||:::. ||  :|...:.|..:.::...:|            .|.||.|.:|...:.
 Frog     5 YSPVLQSLLGTLLTWGLTAAGSALVFIFSSGQRQILDG------------SLGFAAGVMLAASYW 57

  Fly    95 HLLP---EAWEGDNQDPSSHPSLRSGLWVLSGILIFTIVEKIFSGYASADEENPQPKCVEIANCL 156
            .||.   |..|..|| ..|...:.:.:..|.|.....:.:::......:::........:.:..:
 Frog    58 SLLAPAIEMAENSNQ-YGSFAFVPAAVGFLVGAGFVYLADQLMPALGFSEDPYSIATLNQDSKPI 121

  Fly   157 LRRHGGQLPEG-ETSESCGGACDIEDV-----------GKVCFLREQEQKSKERKEQPKKVAGY- 208
            ..:..|.|.|. |.|...|.....:|.           |.|..|.|.......|:...|..:.: 
 Frog   122 KEKDEGDLYEDKELSIRIGRGGFHQDKIENGDVYQRKRGTVSPLAEDFSMLNPREAAHKGGSSWR 186

  Fly   209 ---LNLLANSIDNFTHGLAVAGSF-------LVSFRHGILATFAILLHEIPHEVGDFAILLRSGF 263
               |.:||.:|.|...||||...|       ..:|.:.......|.:...|..:.....|..:|.
 Frog   187 RIMLLILAITIHNIPEGLAVGVGFGAIGKTPSATFENARNLALGIGIQNFPEGLAVSLPLRGAGV 251

  Fly   264 SRWDA----ARAQLLTAGAGLLGALVAIGGSGVTSAMEARTSWIMPFTAGGFLHIALVTVLPD 322
            |.|.|    ..:.::...|||||. :||      |..|....:.:.|.||..:::....::|:
 Frog   252 STWKAFWYGQLSGMVEPIAGLLGT-IAI------SLAEPLLPYALAFAAGAMVYVVTDDIIPE 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zip99CNP_001189313.1 Zip 34..350 CDD:280666 68/322 (21%)
slc39a11NP_001016721.1 ZupT 25..336 CDD:223505 61/303 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.