DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zip99C and Slc39a14

DIOPT Version :9

Sequence 1:NP_001189313.1 Gene:Zip99C / 43533 FlyBaseID:FBgn0039714 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001100745.1 Gene:Slc39a14 / 306009 RGDID:1307026 Length:490 Species:Rattus norvegicus


Alignment Length:365 Identity:94/365 - (25%)
Similarity:148/365 - (40%) Gaps:84/365 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 WVFSLLGSVVIGLSGIFPLIIIPTEEKMAKEGYKDPADSKLLRVLLSFAVGGLLGDVFLHLLPEA 100
            |.|..|...:|.|:.:..::::|..||        ...|::|...::.::|.||.:....|:|||
  Rat   153 WGFGFLSVSLINLASLLGVLVLPCTEK--------AFFSRVLTYFIALSIGTLLSNALFQLIPEA 209

  Fly   101 WEGDNQDPSSHPSLRSGLWVLSGILIFTIVEKIFSGYASADEENPQPKCVEIANCLLRRHGGQ-- 163
            : |.|  |..:...:|.: |..|..:|...|||.........|:              .||..  
  Rat   210 F-GFN--PQDNYVSKSAV-VFGGFYLFFFTEKILKMLLKQKNEH--------------HHGHNHF 256

  Fly   164 ----LP------EGETSESCGGACDIEDVGKVCFLREQEQKSKERKEQPKKVAGYLNL------- 211
                ||      ||.|.:...|..| ..:.:.|   ..:...|......|.:.|.:::       
  Rat   257 TSETLPSKKDQEEGVTEKLQNGDLD-HMIPQHC---NNDLDGKAPSTDEKVIVGSMSVQDLQASQ 317

  Fly   212 ----------------------LANSIDNFTHGLAVAGSFLVSFRHGILATFAILLHEIPHEVGD 254
                                  |::.:.||..|||:..||.||...||..:.|||..|.|||:||
  Rat   318 SACYWLKGVRYSDIGTLAWMITLSDGLHNFIDGLAIGASFTVSVFQGISTSVAILCEEFPHELGD 382

  Fly   255 FAILLRSGFSRWDAARAQLLTAGAGLLGALVAIGGSGVTSAMEARTSWIMPFTAGGFLHIALVTV 319
            |.|||.:|.|...|.....|:|....:|.     ..|:.:......:||.....|.||:|||..:
  Rat   383 FVILLNAGMSIQQALFFNFLSACCCYVGL-----AFGILAGSHFSANWIFALAGGMFLYIALADM 442

  Fly   320 LPDL---LKEEERKES-----IKQLLALVFGIALMAVMTM 351
            .|::   .:|:|:|:|     :.|.|.|:.|.::|.|:||
  Rat   443 FPEMNEVCQEDEKKDSFLVPFVIQNLGLLTGFSIMLVLTM 482

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zip99CNP_001189313.1 Zip 34..350 CDD:280666 92/362 (25%)
Slc39a14NP_001100745.1 Zip 150..481 CDD:280666 92/362 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0428
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D657777at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.