DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zip99C and Slc39a11

DIOPT Version :9

Sequence 1:NP_001189313.1 Gene:Zip99C / 43533 FlyBaseID:FBgn0039714 Length:355 Species:Drosophila melanogaster
Sequence 2:XP_006247726.1 Gene:Slc39a11 / 287796 RGDID:1311981 Length:374 Species:Rattus norvegicus


Alignment Length:277 Identity:59/277 - (21%)
Similarity:100/277 - (36%) Gaps:83/277 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 AVGGLLGDVFLH----LLPEAWEGDNQDPSSHPSLRSGLWVLSGILIFTIVEKIFSGYASADEEN 144
            |||..||..|::    |:|..  |..:||.:..:|.         |...:|:|       :|.::
  Rat   114 AVGFTLGAAFVYLADLLMPHL--GAGEDPQTALALN---------LDPALVKK-------SDLKD 160

  Fly   145 PQPKCVEIANCLLRRHGGQLPEGETSESCGGACDIEDVGKVCFLREQEQKSKERKE--------- 200
            |       |:.|       .||.|.|...|....:.|       :.:..:..:||:         
  Rat   161 P-------ASLL-------FPERELSIRIGSTVLLSD-------KRENGEVYQRKKLAATDFPEG 204

  Fly   201 ------------QP-----KKVAGYLNLLANSIDNFTHGLAVAGSF-------LVSFRHGILATF 241
                        ||     :::|  |.:||.:|.|...||||...|       ..:|........
  Rat   205 AAPSGPVHGNSGQPGVSSWRRIA--LLILAITIHNIPEGLAVGVGFGAVEKTASATFESARNLAI 267

  Fly   242 AILLHEIPHEVGDFAILLRSGFSRWDAA-RAQLLTAGAGLLGALVAIGGSGVTSAMEARTSWIMP 305
            .|.:...|..:.....|..:|||.|.|. ..||    :|::..|..:.|:......|....:.:.
  Rat   268 GIGIQNFPEGLAVSLPLRGAGFSTWKAFWYGQL----SGMVEPLAGVFGAFAVVLAEPVLPYALA 328

  Fly   306 FTAGGFLHIALVTVLPD 322
            |.||..:::.:..::|:
  Rat   329 FAAGAMVYVVMDDIIPE 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zip99CNP_001189313.1 Zip 34..350 CDD:280666 59/277 (21%)
Slc39a11XP_006247726.1 ZupT 38..374 CDD:223505 59/277 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0428
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.