DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zip99C and SLC39A6

DIOPT Version :9

Sequence 1:NP_001189313.1 Gene:Zip99C / 43533 FlyBaseID:FBgn0039714 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_036451.4 Gene:SLC39A6 / 25800 HGNCID:18607 Length:755 Species:Homo sapiens


Alignment Length:462 Identity:96/462 - (20%)
Similarity:172/462 - (37%) Gaps:128/462 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 DEHIAMIYSNLMDQYMPEYFKSFEYTPWVFSLLGSVVIGLSGIFPLIIIPTEEKMAKEGYKDPAD 73
            |....:|:::.....:|....|.:.. ||...:...:|....:..:|::|.   |.:..:|    
Human   299 DARSCLIHTSEKKAEIPPKTYSLQIA-WVGGFIAISIISFLSLLGVILVPL---MNRVFFK---- 355

  Fly    74 SKLLRVLLSFAVGGLLGDVFLHLLPEAWEG-----DNQDPS---------SHPSLRS-------- 116
             .||..|::.|||.|.||.||||||.:...     .:::|:         ||.|.::        
Human   356 -FLLSFLVALAVGTLSGDAFLHLLPHSHASHHHSHSHEEPAMEMKRGPLFSHLSSQNIEESAYFD 419

  Fly   117 ----GLWVLSGILIFTIVEKIFS------------------------------------------ 135
                ||..|.|:....:||.:.:                                          
Human   420 STWKGLTALGGLYFMFLVEHVLTLIKQFKDKKKKNQKKPENDDDVEIKKQLSKYESQLSTNEEKV 484

  Fly   136 -------GYASADEENP------QPKCVEIANCLL-RRHGGQLPEGETSESCGGACDI---EDVG 183
                   ||..||.:.|      ||..:|....:: ..|..::........|...|..   :.:|
Human   485 DTDDRTEGYLRADSQEPSHFDSQQPAVLEEEEVMIAHAHPQEVYNEYVPRGCKNKCHSHFHDTLG 549

  Fly   184 KVCFL-----------------------REQEQKSKERKEQPKKVAGYLNLLANSIDNFTHGLAV 225
            :...|                       ..|....:|.|:.......::.::.:.:.||:.|||:
Human   550 QSDDLIHHHHDYHHILHHHHHQNHHPHSHSQRYSREELKDAGVATLAWMVIMGDGLHNFSDGLAI 614

  Fly   226 AGSFLVSFRHGILATFAILLHEIPHEVGDFAILLRSGFSRWDAARAQLLTAGAGLLGALVAIGGS 290
            ..:|......|:..:.|:..||:|||:||||:||::|.:   ..:|.|..|.:.:|..|....|.
Human   615 GAAFTEGLSSGLSTSVAVFCHELPHELGDFAVLLKAGMT---VKQAVLYNALSAMLAYLGMATGI 676

  Fly   291 GVTSAMEARTSWIMPFTAGGFLHIALVTVLPDLLKEEERKESIK-------QLLALVFGIALMAV 348
            .:....|..:.||...|||.|:::|||.::|::|..:.......       |...::.|..:|.:
Human   677 FIGHYAENVSMWIFALTAGLFMYVALVDMVPEMLHNDASDHGCSRWGYFFLQNAGMLLGFGIMLL 741

  Fly   349 MTMLFEH 355
            :: :|||
Human   742 IS-IFEH 747

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zip99CNP_001189313.1 Zip 34..350 CDD:280666 89/430 (21%)
SLC39A6NP_036451.4 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 95..186
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 202..246
Zip 323..742 CDD:308248 89/430 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0428
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D657777at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.