DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zip99C and SPAP8A3.03

DIOPT Version :9

Sequence 1:NP_001189313.1 Gene:Zip99C / 43533 FlyBaseID:FBgn0039714 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_594942.1 Gene:SPAP8A3.03 / 2542125 PomBaseID:SPAP8A3.03 Length:453 Species:Schizosaccharomyces pombe


Alignment Length:357 Identity:107/357 - (29%)
Similarity:165/357 - (46%) Gaps:75/357 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 KSFEYTPWVFSLLGSVVIGLSGIFPLIIIPTEEKMAKEGYKDPADSKLLRVLLSFAVGGLLGDVF 93
            |.|.|:.....:|.:.:..:.....::::|..           .|:.:|.:.::.:.|.||||||
pombe   129 KQFSYSSGTNGILATFLTAIPPNIFILLVPKS-----------FDTSMLNLFVAVSAGSLLGDVF 182

  Fly    94 LHLLPEAWEGDNQD-PSSHPSLRSGLWVLSGILIFTIVEKIFSGYASADEENP----QPKCVEIA 153
            |.|||..:..:..| |:|  |:.|   :|.|.|:|.:::|   |......|.|    :||     
pombe   183 LQLLPTVYSTNGGDFPAS--SVYS---ILIGALVFFLMDK---GIRILIHERPSSLSKPK----- 234

  Fly   154 NCLLRRHGGQLPEGETSESC---GGACDIEDVGKVCFLREQ----EQKSKER------------- 198
                       .:||.:.|.   ..:....||..|..||::    :|.||..             
pombe   235 -----------KDGEETSSVNKPSASSTQTDVKGVEGLRKRNVKDDQNSKGHEPDLIRHVVEEVS 288

  Fly   199 KEQPKKVAGYLNLLANSIDNFTHGLAVAGSFLVSFRHGILATFAILLHEIPHEVGDFAILLRSGF 263
            :|...|...|||||.:|..||..|||:..:|..:...||..|||:||||||.|:||.|||||:|:
pombe   289 EEYNDKTVVYLNLLCDSFHNFMDGLAITSAFFTNTSIGISTTFAVLLHEIPAEIGDLAILLRNGY 353

  Fly   264 SRWDAARAQLLTAGAGLLGALVAIGGSGVTSAMEARTSW-------IMPFTAGGFLHIALVTVLP 321
            ::......|::|...|||||:||......:|:.....|:       ::||||||||:||.:.|.|
pombe   354 TKSQVLVLQMITMVTGLLGAIVATYIYTASSSSSPYGSFLLQLEDKLLPFTAGGFLYIAYLGVFP 418

  Fly   322 DLLKEEERKESIKQLLALVFGIALMAVMTMLF 353
            :||:....|..:        |..:...:.|:|
pombe   419 ELLEINLSKGKL--------GNMIYTALYMMF 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zip99CNP_001189313.1 Zip 34..350 CDD:280666 102/347 (29%)
SPAP8A3.03NP_594942.1 Zip 139..450 CDD:280666 104/347 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 126 1.000 Domainoid score I1378
eggNOG 1 0.900 - - E1_COG0428
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 127 1.000 Inparanoid score I1444
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001345
OrthoInspector 1 1.000 - - otm47363
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR16950
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1954
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.950

Return to query results.
Submit another query.