DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zip99C and slc39a4

DIOPT Version :9

Sequence 1:NP_001189313.1 Gene:Zip99C / 43533 FlyBaseID:FBgn0039714 Length:355 Species:Drosophila melanogaster
Sequence 2:XP_031760368.1 Gene:slc39a4 / 100485091 XenbaseID:XB-GENE-6049378 Length:681 Species:Xenopus tropicalis


Alignment Length:349 Identity:96/349 - (27%)
Similarity:156/349 - (44%) Gaps:69/349 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 WVFSLLGSVVIGLSGIFPLIIIPTEEKMAKEGYKDPADSKLLRVLLSFAVGGLLGDVFLHLLPE- 99
            :::..:.::|:.|..:..:.|:..........|       :::..:|.|||.|.||..|||:|: 
 Frog   362 YIYGTIATLVVSLCALLGISILLCTSCTTAYQY-------IIQFFVSLAVGSLTGDAVLHLIPQL 419

  Fly   100 -AWEGDNQDPSSHPSL----RSGLW----VLSGILIFTIVEKIFSGYASADEENPQPKCVEIANC 155
             ...| :.||..|...    ||.:|    ||.||.:|.::||:||....:.||      .|.|| 
 Frog   420 LGLHG-HSDPQGHSHQEEEDRSHIWKLLAVLGGIYLFFLMEKLFSILMISGEE------AEGAN- 476

  Fly   156 LLRRHG-------------------GQLPEGETSESCGGACDIEDVGKVCFLREQEQKSKERKEQ 201
                ||                   .|..|.:....|  |.|:|       .....||:|.|:.|
 Frog   477 ----HGHCDHGLSLQNYHQDKERRKEQKSESQADLVC--ATDVE-------FGSGRQKAKSRELQ 528

  Fly   202 PKKVAGYLNLLANSIDNFTHGLAVAGSFLVSFRHGILATFAILLHEIPHEVGDFAILLRSGFS-R 265
               :..|:..:.::|.||..|||:..:|..|::.|:..:.|:|.||:|||:||||.||.:|.. |
 Frog   529 ---MIPYMITIGDAIHNFADGLAIGAAFSTSWKTGLATSLAVLCHELPHELGDFAALLHAGLRVR 590

  Fly   266 WDAARAQLLTAGAGLLGALVAIGGSGVTSAMEARTSWIMPFTAGGFLHIALVTVLPDLLKEEERK 330
            |     .||...:..|.|.:.:..|...||.||...||.....|.||::||..:||.::..:..:
 Frog   591 W-----ALLLNFSSALTAFIGLYISLSISADEAVQQWIFTVATGLFLYVALADMLPAMMNVKLHR 650

  Fly   331 ESI---KQLLALVFGIALMAVMTM 351
            ..|   ...|.::.|..::.::::
 Frog   651 PWILFFLHNLGILLGWVILLILSL 674

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zip99CNP_001189313.1 Zip 34..350 CDD:280666 96/346 (28%)
slc39a4XP_031760368.1 ZIP4_domain 79..>153 CDD:408101
Zip 363..672 CDD:396884 96/344 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D657777at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.