DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS8 and RPS8A

DIOPT Version :9

Sequence 1:NP_001247362.1 Gene:RpS8 / 43532 FlyBaseID:FBgn0039713 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_009481.1 Gene:RPS8A / 852206 SGDID:S000000168 Length:200 Species:Saccharomyces cerevisiae


Alignment Length:208 Identity:131/208 - (62%)
Similarity:160/208 - (76%) Gaps:8/208 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGISRDSAHKRRATGGKRKSLRKKRKFELGRPAANTKLGSGRVHKVRTRGGNTKLRALRLETGNF 65
            |||||||.|||.|||.||...||||||||||..||||:|:.|:|.|||||||.|.||||:|||||
Yeast     1 MGISRDSRHKRSATGAKRAQFRKKRKFELGRQPANTKIGAKRIHSVRTRGGNKKYRALRIETGNF 65

  Fly    66 AWASEGVARKTRIADVVYNASNNELVRTKTLVKNSIVVIDATPFRQWYEAHYVLPLGRKRNPKHA 130
            :|||||:::|||||.|||:.||||||||.||.|.:||.|||||||||:||||...||:|:|    
Yeast    66 SWASEGISKKTRIAGVVYHPSNNELVRTNTLTKAAIVQIDATPFRQWFEAHYGQTLGKKKN---- 126

  Fly   131 QKEDENDVLTKKRSEKVMKKYLERQKYGKVEQALEDQFTSGRILACISSRPGQCGRSDGYILEGK 195
            .||:|    |..:|:...:|:..|....|:|.::|.||::||:.|||||||||.||.|||||||:
Yeast   127 VKEEE----TVAKSKNAERKWAARAASAKIESSVESQFSAGRLYACISSRPGQSGRCDGYILEGE 187

  Fly   196 ELEFYLKKIKSKK 208
            ||.|||:::.:||
Yeast   188 ELAFYLRRLTAKK 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS8NP_001247362.1 PTZ00148 1..208 CDD:240292 129/206 (63%)
RPS8ANP_009481.1 PTZ00148 1..200 CDD:240292 129/206 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157346465
Domainoid 1 1.000 240 1.000 Domainoid score I372
eggNOG 1 0.900 - - E1_COG2007
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H133143
Inparanoid 1 1.050 262 1.000 Inparanoid score I623
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53636
OrthoFinder 1 1.000 - - FOG0001886
OrthoInspector 1 1.000 - - otm46730
orthoMCL 1 0.900 - - OOG6_100802
Panther 1 1.100 - - LDO PTHR10394
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1250
SonicParanoid 1 1.000 - - X1244
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.