DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS8 and RPS8

DIOPT Version :9

Sequence 1:NP_001247362.1 Gene:RpS8 / 43532 FlyBaseID:FBgn0039713 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_001003.1 Gene:RPS8 / 6202 HGNCID:10441 Length:208 Species:Homo sapiens


Alignment Length:208 Identity:145/208 - (69%)
Similarity:172/208 - (82%) Gaps:2/208 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGISRDSAHKRRATGGKRKSLRKKRKFELGRPAANTKLGSGRVHKVRTRGGNTKLRALRLETGNF 65
            ||||||:.||||.||||||...||||:||||||||||:|..|:|.||.||||.|.|||||:.|||
Human     1 MGISRDNWHKRRKTGGKRKPYHKKRKYELGRPAANTKIGPRRIHTVRVRGGNKKYRALRLDVGNF 65

  Fly    66 AWASEGVARKTRIADVVYNASNNELVRTKTLVKNSIVVIDATPFRQWYEAHYVLPLGRKRNPKHA 130
            :|.||...|||||.||||||||||||||||||||.||:||:||:|||||:||.||||||:..|..
Human    66 SWGSECCTRKTRIIDVVYNASNNELVRTKTLVKNCIVLIDSTPYRQWYESHYALPLGRKKGAKLT 130

  Fly   131 QKEDENDVLTKKRSEKVMKKYLERQKYGKVEQALEDQFTSGRILACISSRPGQCGRSDGYILEGK 195
            .:|:|  :|.||||:|:.|||.||:|..|:...||:||..|::||||:||||||||:|||:||||
Human   131 PEEEE--ILNKKRSKKIQKKYDERKKNAKISSLLEEQFQQGKLLACIASRPGQCGRADGYVLEGK 193

  Fly   196 ELEFYLKKIKSKK 208
            ||||||:|||::|
Human   194 ELEFYLRKIKARK 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS8NP_001247362.1 PTZ00148 1..208 CDD:240292 144/206 (70%)
RPS8NP_001003.1 PTZ00148 1..206 CDD:240292 144/206 (70%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..27 19/25 (76%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159623
Domainoid 1 1.000 275 1.000 Domainoid score I1767
eggNOG 1 0.900 - - E1_COG2007
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H133143
Inparanoid 1 1.050 302 1.000 Inparanoid score I2685
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53636
OrthoDB 1 1.010 - - D1278610at2759
OrthoFinder 1 1.000 - - FOG0001886
OrthoInspector 1 1.000 - - oto89450
orthoMCL 1 0.900 - - OOG6_100802
Panther 1 1.100 - - LDO PTHR10394
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1250
SonicParanoid 1 1.000 - - X1244
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.