DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS8 and rps8a

DIOPT Version :9

Sequence 1:NP_001247362.1 Gene:RpS8 / 43532 FlyBaseID:FBgn0039713 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_999958.1 Gene:rps8a / 407690 ZFINID:ZDB-GENE-030131-8626 Length:208 Species:Danio rerio


Alignment Length:208 Identity:143/208 - (68%)
Similarity:172/208 - (82%) Gaps:2/208 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGISRDSAHKRRATGGKRKSLRKKRKFELGRPAANTKLGSGRVHKVRTRGGNTKLRALRLETGNF 65
            ||||||:.||||.||||||.:.||||:||||||||||:|..|:|.:|.||||.|.|||||:.|||
Zfish     1 MGISRDNWHKRRRTGGKRKPVHKKRKYELGRPAANTKIGPRRIHTIRVRGGNKKYRALRLDVGNF 65

  Fly    66 AWASEGVARKTRIADVVYNASNNELVRTKTLVKNSIVVIDATPFRQWYEAHYVLPLGRKRNPKHA 130
            :|.||...|||||.||||||||||||||||||||.:|::|:||:|||||:||.||||||:..|..
Zfish    66 SWGSECCTRKTRIIDVVYNASNNELVRTKTLVKNCVVLVDSTPYRQWYESHYALPLGRKKGAKLT 130

  Fly   131 QKEDENDVLTKKRSEKVMKKYLERQKYGKVEQALEDQFTSGRILACISSRPGQCGRSDGYILEGK 195
            .:|:|  :|.||||:||.||:..|:|..|:...||:||..|::|||||||||||||:|||:||||
Zfish   131 PEEEE--ILNKKRSKKVQKKFTLRRKTAKISPLLEEQFLQGKLLACISSRPGQCGRADGYVLEGK 193

  Fly   196 ELEFYLKKIKSKK 208
            ||||||:|||:||
Zfish   194 ELEFYLRKIKAKK 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS8NP_001247362.1 PTZ00148 1..208 CDD:240292 141/206 (68%)
rps8aNP_999958.1 PTZ00148 1..206 CDD:240292 141/206 (68%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..27 19/25 (76%)
Ribosomal_S8e_like 5..190 CDD:211392 124/186 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170595828
Domainoid 1 1.000 272 1.000 Domainoid score I1760
eggNOG 1 0.900 - - E1_COG2007
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 301 1.000 Inparanoid score I2660
OMA 1 1.010 - - QHG53636
OrthoDB 1 1.010 - - D1278610at2759
OrthoFinder 1 1.000 - - FOG0001886
OrthoInspector 1 1.000 - - otm26354
orthoMCL 1 0.900 - - OOG6_100802
Panther 1 1.100 - - O PTHR10394
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1250
SonicParanoid 1 1.000 - - X1244
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1514.800

Return to query results.
Submit another query.