DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS8 and rps802

DIOPT Version :9

Sequence 1:NP_001247362.1 Gene:RpS8 / 43532 FlyBaseID:FBgn0039713 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_593100.1 Gene:rps802 / 2543354 PomBaseID:SPAC521.05 Length:200 Species:Schizosaccharomyces pombe


Alignment Length:208 Identity:118/208 - (56%)
Similarity:146/208 - (70%) Gaps:8/208 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGISRDSAHKRRATGGKRKSLRKKRKFELGRPAANTKLGSGRVHKVRTRGGNTKLRALRLETGNF 65
            |||:|||.|||.|||.||...||||||||||..:||::|..|:|:||.||||.|.|||||::|||
pombe     1 MGITRDSRHKRSATGAKRAQYRKKRKFELGRQPSNTRIGPKRIHEVRVRGGNKKFRALRLDSGNF 65

  Fly    66 AWASEGVARKTRIADVVYNASNNELVRTKTLVKNSIVVIDATPFRQWYEAHYVLPLGRKRNPKHA 130
            :|.||||::||||..|.|:.||||||||.||.|::||.|||.|||.|||.||.:.:|.|.....|
pombe    66 SWGSEGVSKKTRIIQVAYHPSNNELVRTNTLTKSAIVQIDAAPFRVWYETHYGILMGSKGKKATA 130

  Fly   131 QKEDENDVLTKKRSEKVMKKYLERQKYGKVEQALEDQFTSGRILACISSRPGQCGRSDGYILEGK 195
                    ....:|:.|.:|:..|....||:.|||.||.:||:.|.:||||||.||.|||||||:
pombe   131 --------TPTPKSKHVQRKHSARLGDSKVDSALETQFAAGRLYAVVSSRPGQSGRCDGYILEGE 187

  Fly   196 ELEFYLKKIKSKK 208
            ||.|||:::..||
pombe   188 ELHFYLRRMAPKK 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS8NP_001247362.1 PTZ00148 1..208 CDD:240292 116/206 (56%)
rps802NP_593100.1 PTZ00148 1..200 CDD:240292 116/206 (56%)
Ribosomal_S8e_like 5..184 CDD:211392 104/186 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 213 1.000 Domainoid score I588
eggNOG 1 0.900 - - E1_COG2007
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H133143
Inparanoid 1 1.050 233 1.000 Inparanoid score I848
OMA 1 1.010 - - QHG53636
OrthoFinder 1 1.000 - - FOG0001886
OrthoInspector 1 1.000 - - otm47182
orthoMCL 1 0.900 - - OOG6_100802
Panther 1 1.100 - - LDO PTHR10394
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1250
SonicParanoid 1 1.000 - - X1244
TreeFam 1 0.960 - -
1413.860

Return to query results.
Submit another query.