powered by:
Protein Alignment RpS8 and W09C5.1
DIOPT Version :9
Sequence 1: | NP_001247362.1 |
Gene: | RpS8 / 43532 |
FlyBaseID: | FBgn0039713 |
Length: | 208 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001366901.1 |
Gene: | W09C5.1 / 173232 |
WormBaseID: | WBGene00012351 |
Length: | 259 |
Species: | Caenorhabditis elegans |
Alignment Length: | 59 |
Identity: | 19/59 - (32%) |
Similarity: | 26/59 - (44%) |
Gaps: | 5/59 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 122 GRKRNPKHAQKEDEN---DVLTKKRSEKVMKKYLERQKYGKVEQALED--QFTSGRILA 175
|.|....|.::..|. ..|.|:..||..|..:|:...|.|...|.| |.|||.:|:
Worm 44 GHKAKLYHKKRYSEKVEMRKLLKQHEEKDQKNTVEQPDKGAVPAYLLDRQQQTSGTVLS 102
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG2007 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.