DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS8 and W09C5.1

DIOPT Version :9

Sequence 1:NP_001247362.1 Gene:RpS8 / 43532 FlyBaseID:FBgn0039713 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_001366901.1 Gene:W09C5.1 / 173232 WormBaseID:WBGene00012351 Length:259 Species:Caenorhabditis elegans


Alignment Length:59 Identity:19/59 - (32%)
Similarity:26/59 - (44%) Gaps:5/59 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 GRKRNPKHAQKEDEN---DVLTKKRSEKVMKKYLERQKYGKVEQALED--QFTSGRILA 175
            |.|....|.::..|.   ..|.|:..||..|..:|:...|.|...|.|  |.|||.:|:
 Worm    44 GHKAKLYHKKRYSEKVEMRKLLKQHEEKDQKNTVEQPDKGAVPAYLLDRQQQTSGTVLS 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS8NP_001247362.1 PTZ00148 1..208 CDD:240292 19/59 (32%)
W09C5.1NP_001366901.1 NSA2 4..259 CDD:211393 19/59 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2007
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.