DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS8 and LOC100363452

DIOPT Version :9

Sequence 1:NP_001247362.1 Gene:RpS8 / 43532 FlyBaseID:FBgn0039713 Length:208 Species:Drosophila melanogaster
Sequence 2:XP_038962391.1 Gene:LOC100363452 / 100363452 RGDID:2322993 Length:208 Species:Rattus norvegicus


Alignment Length:208 Identity:144/208 - (69%)
Similarity:173/208 - (83%) Gaps:2/208 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGISRDSAHKRRATGGKRKSLRKKRKFELGRPAANTKLGSGRVHKVRTRGGNTKLRALRLETGNF 65
            ||||||:.||||.||||||...||||:||||||||||:|..|:|.|:.||||.|.|||||:.|||
  Rat     1 MGISRDNWHKRRKTGGKRKPYHKKRKYELGRPAANTKIGPRRIHTVQVRGGNKKYRALRLDVGNF 65

  Fly    66 AWASEGVARKTRIADVVYNASNNELVRTKTLVKNSIVVIDATPFRQWYEAHYVLPLGRKRNPKHA 130
            :|.||...|||||.||||||||||||||||||||.||:||:||:|||||:||.||||||:..|..
  Rat    66 SWGSECCTRKTRIIDVVYNASNNELVRTKTLVKNCIVLIDSTPYRQWYESHYALPLGRKKGAKLT 130

  Fly   131 QKEDENDVLTKKRSEKVMKKYLERQKYGKVEQALEDQFTSGRILACISSRPGQCGRSDGYILEGK 195
            .:|:|  :|.||||:|:.|||.||:|..|:.:.||:||..|::||||:||||||||:|||:||||
  Rat   131 PEEEE--ILNKKRSKKIQKKYDERKKNAKISRLLEEQFQQGKLLACIASRPGQCGRADGYVLEGK 193

  Fly   196 ELEFYLKKIKSKK 208
            ||||||:|||::|
  Rat   194 ELEFYLRKIKARK 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS8NP_001247362.1 PTZ00148 1..208 CDD:240292 143/206 (69%)
LOC100363452XP_038962391.1 PTZ00148 1..206 CDD:240292 143/206 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166353674
Domainoid 1 1.000 275 1.000 Domainoid score I1682
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 302 1.000 Inparanoid score I2589
OMA 1 1.010 - - QHG53636
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001886
OrthoInspector 1 1.000 - - otm45141
orthoMCL 1 0.900 - - OOG6_100802
Panther 1 1.100 - - O PTHR10394
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1244
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1211.900

Return to query results.
Submit another query.