DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15514 and Zbed4

DIOPT Version :9

Sequence 1:NP_651739.1 Gene:CG15514 / 43531 FlyBaseID:FBgn0039712 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_001128272.1 Gene:Zbed4 / 315211 RGDID:1305949 Length:1170 Species:Rattus norvegicus


Alignment Length:234 Identity:63/234 - (26%)
Similarity:94/234 - (40%) Gaps:55/234 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 CKHCEKTLSSKHT----SSNLTRHLIRNHKLLARSIFAGEEGKMLAELKDELEASASEDLSMELG 82
            |::|...:|....    :|.|.|||.|.|.            :::...||.|..|.:......|.
  Rat   479 CRYCSCVISRGKKGDVGTSCLMRHLYRRHP------------EVVGNQKDFLGTSLANSPYATLA 531

  Fly    83 EGETKSAVRGIMNA--KLEQEQMERHSQEEMRNKVIGKNNKLWAHFIRISEFMAK--CMHCGKTL 143
            ..|:.|.:..:..|  |..|.....:|:         |.:|||.||...|....|  |:|||:|:
  Rat   532 SAESSSKLTDLPAAIRKNHQGMFPTNSK---------KTSKLWNHFSICSADSTKVVCLHCGRTI 587

  Fly   144 SSKHSSSN-----LMRHIVRRHTSLAK------TLNHSHQHLMTPKKDSYASLERRQAA---DPL 194
            |.....:|     |:||:.|.|..:.|      ||.||      |.......:|...|:   |..
  Rat   588 SRGKKPTNLGTSCLLRHLQRFHGHVLKNDVSEATLPHS------PGIRRPLGMELSGASSLRDST 646

  Fly   195 EKVNFDDVDSIIEKVADHLEEEVTSISLQEPFYEYVVDN 233
            ||  |.|...:.:|:.. |..|:.::.|| |:  .:|||
  Rat   647 EK--FYDSHPVAKKITS-LIAEMIALDLQ-PY--SLVDN 679

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15514NP_651739.1 zf-BED 6..47 CDD:280965 9/28 (32%)
zf-BED 120..160 CDD:280965 18/46 (39%)
Zbed4NP_001128272.1 zf-BED 119..167 CDD:280965
zf-BED 289..337 CDD:280965
zf-BED 461..508 CDD:280965 9/28 (32%)
zf-BED 562..609 CDD:280965 18/46 (39%)
Dimer_Tnp_hAT 1087..1163 CDD:283379
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.