DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15514 and Zbed4

DIOPT Version :9

Sequence 1:NP_651739.1 Gene:CG15514 / 43531 FlyBaseID:FBgn0039712 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_852077.1 Gene:Zbed4 / 223773 MGIID:2682302 Length:1168 Species:Mus musculus


Alignment Length:236 Identity:62/236 - (26%)
Similarity:93/236 - (39%) Gaps:59/236 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 CKHCEKTLSSKHT----SSNLTRHLIRNHKLLARSIFAGEEGKMLAELKDELEASASEDLSMELG 82
            |::|...:|....    :|.|.|||.|.|.            :::...||.|.||.:......|.
Mouse   477 CRYCSCVISRGKKGDVGTSCLMRHLYRRHP------------EVVGNQKDFLGASLANSPYATLA 529

  Fly    83 EGETKSAVRGI--MNAKLEQEQMERHSQEEMRNKVIGKNNKLWAHFIRISEFMAK--CMHCGKTL 143
            ..|:.|.:..:  :..|..|.....:|:         |.:|||.||...|....|  |:|||:|:
Mouse   530 SAESSSKLTDLPAVVRKNHQGVFPTNSK---------KTSKLWNHFSICSADSTKVVCLHCGRTI 585

  Fly   144 SSKHSSSNLMRHIVRRHTSLAKTLNHSHQHLMTPKKD-SYASLERRQA---------------AD 192
            |.....:||....:.||      |...|.|::  |.| |.|:|.|...               .|
Mouse   586 SRGKKPTNLGTSCLLRH------LQRFHGHVL--KNDVSEATLSRSPGIRRPLGIELSGPSSFRD 642

  Fly   193 PLEKVNFDDVDSIIEKVADHLEEEVTSISLQEPFYEYVVDN 233
            ..||  |.|...:.:|:.. |..|:.::.|| |:  .:|||
Mouse   643 STEK--FYDSHPVAKKITS-LIAEMIALDLQ-PY--SLVDN 677

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15514NP_651739.1 zf-BED 6..47 CDD:280965 9/28 (32%)
zf-BED 120..160 CDD:280965 15/41 (37%)
Zbed4NP_852077.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 22..55
zf-BED 118..165 CDD:335142
zf-BED 289..335 CDD:335142
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 362..443
zf-BED 460..506 CDD:335142 9/28 (32%)
zf-BED 561..607 CDD:335142 18/51 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1040..1059
Required for homodimerization and nuclear accumulation. /evidence=ECO:0000250|UniProtKB:O75132 1083..1168
Dimer_Tnp_hAT 1085..>1134 CDD:368565
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.