DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15514 and zbed4

DIOPT Version :9

Sequence 1:NP_651739.1 Gene:CG15514 / 43531 FlyBaseID:FBgn0039712 Length:309 Species:Drosophila melanogaster
Sequence 2:XP_002932232.1 Gene:zbed4 / 100270676 XenbaseID:XB-GENE-6076969 Length:1148 Species:Xenopus tropicalis


Alignment Length:222 Identity:57/222 - (25%)
Similarity:92/222 - (41%) Gaps:40/222 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 CKHCEKTLSSKHT----SSNLTRHLIRNHKLLARSIFAGEEGKMLAELKDELEASASEDLSMELG 82
            ||:|...:|....    :|.|.|||.|.|..:           :|.:.|.::..:.|...::...
 Frog   459 CKYCSCMISRGKKGDLGTSCLMRHLYRRHPEV-----------ILNQKKIDISLANSPYATLASA 512

  Fly    83 EGETKSAVRGIMNAKLEQEQMERHSQEEMRNKVIGKNNKLWAHFIRISEFMAK--CMHCGKTLSS 145
            |..:|.....|:|          |..:.:......|.:|||.||...|....|  |||||:|:|.
 Frog   513 ECSSKMTELTIVN----------HDNQIVFPTNSKKTSKLWNHFSICSADSTKVICMHCGRTISR 567

  Fly   146 KHSSSN-----LMRHIVRRHTSLAKTLNHSHQHLMTPKKDSYASLERRQAADPLEKV--NFDDVD 203
            ....:|     |:||:.|.|:::.:  |:|....:.| .||...:....||...|..  .|.|..
 Frog   568 GKKPTNLGTSCLLRHLQRFHSNVLQ--NNSVSETLRP-ADSQTPVNTELAASSFEDTTDKFSDSH 629

  Fly   204 SIIEKVADHLEEEVTSISLQEPFYEYV 230
            .:.:|:.. |..|:.::.||.  |.:|
 Frog   630 PVAKKITS-LIAEMIALDLQP--YSFV 653

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15514NP_651739.1 zf-BED 6..47 CDD:280965 10/28 (36%)
zf-BED 120..160 CDD:280965 19/46 (41%)
zbed4XP_002932232.1 zf-BED 105..152 CDD:335142
zf-BED 270..316 CDD:335142
zf-BED 442..488 CDD:335142 10/28 (36%)
zf-BED 541..588 CDD:335142 19/46 (41%)
Dimer_Tnp_hAT 1065..1141 CDD:368565
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.