DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dgt1 and AT3G53860

DIOPT Version :9

Sequence 1:NP_001287595.1 Gene:dgt1 / 43529 FlyBaseID:FBgn0039710 Length:589 Species:Drosophila melanogaster
Sequence 2:NP_190954.1 Gene:AT3G53860 / 824553 AraportID:AT3G53860 Length:281 Species:Arabidopsis thaliana


Alignment Length:285 Identity:62/285 - (21%)
Similarity:99/285 - (34%) Gaps:61/285 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   199 SSSNDAD---------PPCLRNTAQDIEFYESDHESIDS--EDDDPLKHAGVFTRAEAVKIAETK 252
            ||||.|.         .|.:||.........|...|..:  ::|:.|..:...||.|.::.....
plant    22 SSSNAASSTAVASTSVEPQIRNPKPSTNVLPSTSNSPITMLQEDEILASSSHLTRPELLRRRADN 86

  Fly   253 LIKLQGLYREQISYLQNVLRQRRRKYLHDIRRERELYCSIH-DQLKDTPHERKLYEQLKALNSYH 316
            |.:|...|:.....|...|:.:.|.|          :|... .|.||..::          ::..
plant    87 LKQLAKCYKNHYWALMEDLKAQHRDY----------WCKYGVSQFKDEQNQ----------SNKR 131

  Fly   317 RRQGVEAVLYKKLKEKRARDALYAAKSSSNPKCVFTEGGVKCGERTLPCCKHCRKHILEDKRQVL 381
            ||...|.      ...:..|....|.|:|. .|::     .|..:.:...|:|:.|||:|.:|.|
plant   132 RRLDPEG------SGDKGNDGDQYANSNSG-FCMY-----GCKAKAMALTKYCQLHILKDSKQKL 184

  Fly   382 FRACG--VERS---GVVCQEPVASILEDSSCVLHL-----TVAPAKRQYIQKFYEVPSTPPVESI 436
            :..|.  :.||   .::|.:|..:......|.:|.     .||.|.:............||...:
plant   185 YTGCTNVINRSPAGPLLCGKPTLASTVPVLCNVHYQKAQKNVAKALKDAGHNVSSTSKPPPKLHV 249

  Fly   437 FAAGRGLDNFVG--EDPRNEPQPEG 459
            ..|.     ||.  :..|..|..||
plant   250 IVAA-----FVHHIQAQRKNPHKEG 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dgt1NP_001287595.1 zf-C3Hc3H 42..107 CDD:290602
zf-C3Hc3H 349..411 CDD:290602 16/66 (24%)
AT3G53860NP_190954.1 zf-C3Hc3H 155..218 CDD:404731 16/68 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13453
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.