DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment neo and MATN4

DIOPT Version :9

Sequence 1:NP_651733.1 Gene:neo / 43523 FlyBaseID:FBgn0039704 Length:744 Species:Drosophila melanogaster
Sequence 2:NP_001380459.1 Gene:MATN4 / 8785 HGNCID:6910 Length:581 Species:Homo sapiens


Alignment Length:464 Identity:95/464 - (20%)
Similarity:145/464 - (31%) Gaps:145/464 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   227 VASRRECFELCLGENDFTCRSANYDRTSGACELSELDRLTLAGSQAFQVNDGSDYLENHCVDEPN 291
            |.|.|......|.|:.|...|.:..:..|....|.|..:.|..       :|:...|:|||:.|.
Human   178 VGSLRAMASPPLDEHVFLVESFDLIQEFGLQFQSRLCAIDLCA-------EGTHGCEHHCVNSPG 235

  Fly   292 KL---CEFKRLPGRILKTVDSVYQEVSSID-------ECRELCLNSP--YRCHSYDYNDTGDMVC 344
            ..   |:.    |.:|:   ...:...:||       .|:..|:::|  .|||           |
Human   236 SYFCHCQV----GFVLQ---QDQRSCRAIDYCSFGNHSCQHECVSTPGGPRCH-----------C 282

  Fly   345 RLSHHSRATLADVQEPFLEVPEASTYELTSCYNVTIECGGGDMLARIRTSKLFNGKVY------- 402
            |..|       |:|      |:.     .|| .|...|.|.|.....:.  :..|..|       
Human   283 REGH-------DLQ------PDG-----RSC-QVRDLCNGVDHGCEFQC--VSEGLSYRCLCPEG 326

  Fly   403 --AKGSPKSCS------VDVKSALDFELRMNYHDLECNVRQSTAGRYVNDII------------- 446
              .:...|||:      ||:...:|....:...:.|      ...|:||.|:             
Human   327 RQLQADGKSCNRCREGHVDLVLLVDGSKSVRPQNFE------LVKRFVNQIVDFLDVSPEGTRVG 385

  Fly   447 -IQHHDMIVTSSDLG----------LALACQYDLTNKSVSNGVDLDVRGDIMPALSEEV-----I 495
             :|....:.|...||          ..||.:|  ..:....|  |.:|..:..:.||..     .
Human   386 LVQFSSRVRTEFPLGRYGTAAEVKQAVLAVEY--MERGTMTG--LALRHMVEHSFSEAQGARPRA 446

  Fly   496 VESPNVIMRITSRDGSD-----MMRSAEVGDPLALKFEIVDEQSPYEIFIRELVAMDGVDNSEIT 555
            :..|.|.:..|.....|     ..|:.|.|    :....|......|..:||:.:    :.:|: 
Human   447 LNVPRVGLVFTDGRSQDDISVWAARAKEEG----IVMYAVGVGKAVEAELREIAS----EPAEL- 502

  Fly   556 LIDSNGCPTDHFIMGPIYKGSVSGKM--LLSNFDAFKFPSSEVVQFRALVTPCMPSCEPVQCEQE 618
                      |....|.:     |.|  ||.|......|...:.....|.:||  .||.:...|.
Human   503 ----------HVSYAPDF-----GTMTHLLENLRGSICPEEGISAGTELRSPC--ECESLVEFQG 550

  Fly   619 DTSGEFRSL 627
            .|.|...||
Human   551 RTLGALESL 559

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
neoNP_651733.1 PAN_1 120..197 CDD:278453
PAN_AP_HGF 211..285 CDD:238532 13/57 (23%)
PAN_1 294..373 CDD:278453 17/87 (20%)
ZP 381..615 CDD:214579 53/284 (19%)
MATN4NP_001380459.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X161
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.