DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment neo and matn3b

DIOPT Version :9

Sequence 1:NP_651733.1 Gene:neo / 43523 FlyBaseID:FBgn0039704 Length:744 Species:Drosophila melanogaster
Sequence 2:NP_001012385.1 Gene:matn3b / 497645 ZFINID:ZDB-GENE-050221-9 Length:478 Species:Danio rerio


Alignment Length:127 Identity:26/127 - (20%)
Similarity:51/127 - (40%) Gaps:38/127 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   208 YVDRVQNY----KLKTEVKRTV----SVASRRECFELCLGEN-DFTCRS-----ANYDRTSGACE 258
            :|..|:.|    ||.::.:.|:    :.|....|..:|:..| .:.|:.     .|.|:.:.:.:
Zfish   362 HVFYVETYGVIEKLTSKFRETLCGFDACAHGHNCEHICVSNNASYFCKCREGYVINSDKKTCSKQ 426

  Fly   259 LSELDRLTLAGSQAFQVNDGSDYLENHCVDEPNKLCE----FKRLPGRILKTVDSVYQEVSS 316
            .:|..|              :|..||.|      :||    |:|.....::|:.|...::|:
Zfish   427 TNEEAR--------------ADLTENAC------MCEAQIAFQRKVHNSIQTLSSRLDDISN 468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
neoNP_651733.1 PAN_1 120..197 CDD:278453
PAN_AP_HGF 211..285 CDD:238532 16/87 (18%)
PAN_1 294..373 CDD:278453 7/27 (26%)
ZP 381..615 CDD:214579
matn3bNP_001012385.1 vWFA 201..422 CDD:294047 13/59 (22%)
Matrilin_ccoil 436..477 CDD:287378 10/39 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X161
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.