DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment neo and qsm

DIOPT Version :9

Sequence 1:NP_651733.1 Gene:neo / 43523 FlyBaseID:FBgn0039704 Length:744 Species:Drosophila melanogaster
Sequence 2:NP_001286637.1 Gene:qsm / 47065 FlyBaseID:FBgn0028622 Length:414 Species:Drosophila melanogaster


Alignment Length:317 Identity:80/317 - (25%)
Similarity:131/317 - (41%) Gaps:88/317 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   396 LFNGKVYAKGSPK-SCS-----VDV---------KSA-------------------LDFEL---R 423
            ||.|...||||.| .||     ||:         :||                   :|..|   |
  Fly    16 LFCGLAQAKGSHKVHCSEDQMRVDIGLPDAESKDQSAPQIYLEGLKGYPDERCQPQIDGSLAVFR 80

  Fly   424 MNYHDL-ECNVRQSTAGRYVNDII---IQHHDMIV--TSSDLGLALAC------QYDL------- 469
            ::..|. ||.|.     |.||.:.   :.:|.:|:  ||....:::.|      .|::       
  Fly    81 LSLSDFYECGVT-----RMVNQLTGKKVYYHKIIIESTSGKEIVSVKCITTASPAYNVMMNATTG 140

  Fly   470 --TNKSVSNGVDLDVRGDIMPA---------LSEEVIVESPNVIMRI-TSRDGSDMMRSAEV--G 520
              :..:.|.|:...|:.|::||         ::..:...:|...:.| .|:||....|...|  |
  Fly   141 SSSTSTSSGGIHGLVKRDVLPAGFQEPEDLEITTSLTKRAPEPRLSIGVSQDGQKFTRDLTVKSG 205

  Fly   521 DPLALKFEIVDEQSP-YEIFIRELVAMDGVDNSEITLIDSNGCPTDHFIMGPIYKGSVSGKMLLS 584
            .||.::..:.::.:| |.:.:..|...|...:|| ||| ..||..|.::....  .::.|.:|.:
  Fly   206 TPLTMEINLDEDSAPVYGLGVNYLDVTDTHTSSE-TLI-FKGCTVDPYLFENF--NTIDGDILSA 266

  Fly   585 NFDAFKFPSSEVVQFRALVTPCMPSCEPVQCEQEDTSGEFRSLLSYGRKRRSLNTTD 641
            .|.|||||.|..|||||.|..|:..|...||....        :.:||::|.:::.:
  Fly   267 KFKAFKFPDSSYVQFRATVNVCLDKCLGTQCSNNQ--------VGFGRRKREISSAN 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
neoNP_651733.1 PAN_1 120..197 CDD:278453
PAN_AP_HGF 211..285 CDD:238532
PAN_1 294..373 CDD:278453
ZP 381..615 CDD:214579 75/289 (26%)
qsmNP_001286637.1 ZP 30..298 CDD:214579 68/276 (25%)
Zona_pellucida <200..300 CDD:278526 35/103 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28JEZ
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR47327
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.