DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment neo and nompA

DIOPT Version :9

Sequence 1:NP_651733.1 Gene:neo / 43523 FlyBaseID:FBgn0039704 Length:744 Species:Drosophila melanogaster
Sequence 2:NP_524831.2 Gene:nompA / 45587 FlyBaseID:FBgn0016047 Length:1557 Species:Drosophila melanogaster


Alignment Length:586 Identity:139/586 - (23%)
Similarity:213/586 - (36%) Gaps:180/586 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   221 VKRTVSVASRRECFELCLGENDFTCRSANYDRTSGACELSELDRLTLAGSQAFQVNDGSDYLENH 285
            |:|.:.|.|..:|...|:...||.|||.|| |.|.|....:.||                   :.
  Fly   931 VRRALIVPSLIQCERECIESRDFVCRSFNY-RDSAASGYEDRDR-------------------DR 975

  Fly   286 CVDEPNKLCEFKRLPGRILKTVDSVYQEVSSIDECRELCLNSP--YRCHSYDYNDTGDMVCRLSH 348
            ..|.||  ||        |...||           |||.::.|  :...:||:            
  Fly   976 DRDSPN--CE--------LSDRDS-----------RELDIHDPGTFDASNYDF------------ 1007

  Fly   349 HSRATLADVQEPFLEVPEASTYELT------SCYNVTIECGGGDMLARIRTSKLFNGKVYAKGSP 407
                                 ||.:      .|.:||..|....|...|||.:.|.|::|..|..
  Fly  1008 ---------------------YERSIGRSDGECMDVTQTCNEEGMEFTIRTPEGFLGRIYTYGFY 1051

  Fly   408 KSC-------SVDVKSALDFELRMN----YHDLECNVRQSTAGRY----VNDIIIQHHDMIVTSS 457
            ..|       :|:|       ||::    |.|  |..:     ||    .|.:::|..|.:.||.
  Fly  1052 DRCFFRGNGGTVNV-------LRLSGPQGYPD--CGTQ-----RYGDTLTNIVVVQFSDNVQTSR 1102

  Fly   458 DLGLALACQYDLTNKSV--------SNGVDLDVRGDIMPA---LSEEVIVESPNVIMRITSRDGS 511
            |....|.|.:....::|        .:|..:.:  :.:||   ||.:|         |::.....
  Fly  1103 DKRYNLTCIFRGPGEAVVSSGYIGAGSGSPIPI--EYLPAENTLSSKV---------RLSILYQG 1156

  Fly   512 DMMRSAEVGDPLALKFEIVDEQSPY-EIFIRELVAMDGVDNSEITLIDSNGCPTDHFIMGPIYKG 575
            ....:..|||||..:.|..|..:.. :||...:||.|......|.|||..|||.|.|:...:.| 
  Fly  1157 RPTTTIAVGDPLTFRLEAQDGYNHVTDIFATNVVARDPYSGRSIQLIDRFGCPVDPFVFPELDK- 1220

  Fly   576 SVSGKMLLSNFDAFKFPSSEVVQFRALVTPCMPSCEPVQC-----EQEDTSGEFRSLLSYGRKRR 635
            ...|..|.:.|:|||.|.|..:.|.|.|..|...|:|..|     .||.         |:||:||
  Fly  1221 LRDGDTLEARFNAFKIPESNFLVFEATVRSCREGCQPAYCPGPAGRQEP---------SFGRRRR 1276

  Fly   636 SLNTTDDHPRPR------------------RDIDTSKKSAPSDMLLVQSIQITDKFGFKQDKQES 682
            ||||| :.|.|.                  ..::::..||....:.:...|:.:|....::.::.
  Fly  1277 SLNTT-EIPEPEALALEGSSQLEASTLDEVTVVNSTTVSATLGQVPLNETQLGEKTKETEEPEQV 1340

  Fly   683 GDFYDGNETTFTANEEGH---------GFCVNAI---GLITAATIFLLTQLAVIAIWTYCYQRRQ 735
            .:..:..||.....:|.:         ..|:...   |||||..:.::...::..:....|:|..
  Fly  1341 REMIEVFETREEIEKESYPRKLVAPVETVCMTPAEYHGLITAIILLMILLFSITLVAGLGYRRYW 1405

  Fly   736 K 736
            |
  Fly  1406 K 1406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
neoNP_651733.1 PAN_1 120..197 CDD:278453
PAN_AP_HGF 211..285 CDD:238532 18/63 (29%)
PAN_1 294..373 CDD:278453 13/80 (16%)
ZP 381..615 CDD:214579 71/260 (27%)
nompANP_524831.2 PAN_AP_HGF 150..231 CDD:238532
PAN_AP_HGF 244..>303 CDD:238532
PAN_AP_HGF 349..424 CDD:238532
PAN_AP_HGF 914..1011 CDD:238532 34/153 (22%)
ZP 1025..1264 CDD:214579 72/264 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28JEZ
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR47327
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.