DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment neo and CG12592

DIOPT Version :9

Sequence 1:NP_651733.1 Gene:neo / 43523 FlyBaseID:FBgn0039704 Length:744 Species:Drosophila melanogaster
Sequence 2:NP_731474.1 Gene:CG12592 / 41263 FlyBaseID:FBgn0037811 Length:674 Species:Drosophila melanogaster


Alignment Length:142 Identity:31/142 - (21%)
Similarity:55/142 - (38%) Gaps:25/142 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 ATAKEHLRIRRQAAESVTAAAPNASKVMASEEIK----------DKTEWPGAKETST-------- 66
            |..|.....|::.::|::.|..:..::....|.|          |..|.....||.|        
  Fly   397 AEKKRQKNKRKRLSKSLSGAPEDLEEMEIKHERKRLKSSHGASTDSMEEDNENETMTVAEEHHSD 461

  Fly    67 -EINRTERPVENVETRNSGFDLPAASDLSSSLGSEEDSIYYDNAPVDCNPELVGFEIVTGYVFSA 130
             |::..|.|:|...|.:|  :.|:||:|.....|...::..|...:....:.|...:    ...|
  Fly   462 GEVSNGEVPIEEKPTTSS--EKPSASELPEEGNSAPPALKKDVKRLQAARQAVSHAV----NLLA 520

  Fly   131 PEKLMDSQPGTL 142
            |.|..:::|.||
  Fly   521 PPKATEAEPRTL 532

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
neoNP_651733.1 PAN_1 120..197 CDD:278453 6/23 (26%)
PAN_AP_HGF 211..285 CDD:238532
PAN_1 294..373 CDD:278453
ZP 381..615 CDD:214579
CG12592NP_731474.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28JEZ
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.