DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment neo and T01D1.8

DIOPT Version :9

Sequence 1:NP_651733.1 Gene:neo / 43523 FlyBaseID:FBgn0039704 Length:744 Species:Drosophila melanogaster
Sequence 2:NP_001300591.1 Gene:T01D1.8 / 3896729 WormBaseID:WBGene00044641 Length:189 Species:Caenorhabditis elegans


Alignment Length:188 Identity:39/188 - (20%)
Similarity:70/188 - (37%) Gaps:68/188 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   273 FQVNDGSDYLENHCVDEPNKLCEFKRLPGRILKTVDSVYQEVSSIDECRELCLNSPYRCHSYDYN 337
            :.|:.|||.|                  |||:.:..::..|:                .||::.|
 Worm    53 YSVHHGSDKL------------------GRIVTSKVNIGDEI----------------YHSWNCN 83

  Fly   338 DTGD----MVCRLSHHSRATLADVQEPFLEVPEASTYELTSCY---NVTIECG-GGDMLARIRTS 394
            .:||    :.|.:.::  .|::|..|..:...:....:...|.   |:..:.. .||:.|.|   
 Worm    84 YSGDHKNYLFCVMVNN--CTISDSGEEEIGTRKIQIIDENGCSVFPNILPDISYQGDLSAGI--- 143

  Fly   395 KLFNGKVYAKGSPKSCSVDV-KSALDF--ELRMNYHDLE------CNVRQSTAGRYVN 443
                 ||:|      .::|| .:|:.|  .::|.:.|.|      |. .|....||:|
 Worm   144 -----KVHA------FALDVDTTAVHFTCNIKMLFKDHEQCQRPRCG-NQRRFSRYLN 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
neoNP_651733.1 PAN_1 120..197 CDD:278453
PAN_AP_HGF 211..285 CDD:238532 5/11 (45%)
PAN_1 294..373 CDD:278453 13/82 (16%)
ZP 381..615 CDD:214579 19/73 (26%)
T01D1.8NP_001300591.1 Zona_pellucida <39..179 CDD:391783 34/175 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.