DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment neo and CG15020

DIOPT Version :9

Sequence 1:NP_651733.1 Gene:neo / 43523 FlyBaseID:FBgn0039704 Length:744 Species:Drosophila melanogaster
Sequence 2:NP_647901.1 Gene:CG15020 / 38544 FlyBaseID:FBgn0035543 Length:604 Species:Drosophila melanogaster


Alignment Length:389 Identity:81/389 - (20%)
Similarity:151/389 - (38%) Gaps:68/389 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   373 TSCYNVTIECGGGDMLARIRTSKLFNGKVYAKG---SPKSCSVD--VKSALDFELRMN------Y 426
            |...::..||....|..||..:..|:|.:|:.|   .|....::  .:...:|.:::|      .
  Fly   215 TRVQHIEAECQDDYMKIRIGFNGSFSGLLYSAGYAYDPDCMYINGSGRDYYEFYIQLNRCGTLGK 279

  Fly   427 HDLECNVRQSTAGRYVNDIIIQHHDMIVTSSDLGLALACQ--YDLTNKSVSNGVDLDVRGDIMPA 489
            :.|:...|::......|.:.:|::.:|....|....:.|:  ||.........:|::|      |
  Fly   280 NSLQEESRKNPTNFMWNTVTVQYNPLIEEEYDEHFKVTCEYGYDFWKTVTFPFLDVEV------A 338

  Fly   490 LSEEVI--VESPNVIMRITSR---DGSDMMRSAEVGDPLALKFEIVDEQSPYEIFIRELVAMDGV 549
            ....|:  :..|...|.|.:.   .|..:.....|||||.|...:..:...::|.:.:..|.:|.
  Fly   339 TGNPVVFTLSPPECYMEIQNGYGIGGPRVTGPVRVGDPLTLIIYMRSKYDGFDIVVNDCYAHNGA 403

  Fly   550 DNSEITLIDSNGCPTDHFIMGPIYKGSVSGK-----MLLSNFDAFKFPSSEVVQFRALVTPCMPS 609
             |..|.|||.:|||.|..::.. ::||.|..     .:.:....|:|..|..:.....|..|...
  Fly   404 -NKRIQLIDQHGCPVDDKLISR-FRGSWSDSGVYETQVYAYMKTFRFTGSPALYIECDVRMCHGR 466

  Fly   610 CEPVQCEQEDTSGEFRSLLSYGRKRRSLNTTDDHPRPRRDID-----TSKKSAPS---DMLLVQS 666
            |....|       .:|:|.:..::..|..|..:...|....|     |...:|.|   ::.|.||
  Fly   467 CPSQPC-------HWRNLKAVTKRDTSNMTATNISIPPLSADGEGLTTESPTANSLSENVNLFQS 524

  Fly   667 IQITDKFGFKQDKQESGDFYDGNET-------------TFTANEEGHGFCVNAIGLITAATIFL 717
            :::     .::.:.:..|.|...:|             ||:|...|   | :|:..:...|:|:
  Fly   525 LRV-----LQEGETDGDDVYAHRQTKPLSPHQTCLKTSTFSALTAG---C-SAVLCVLTVTLFI 579

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
neoNP_651733.1 PAN_1 120..197 CDD:278453
PAN_AP_HGF 211..285 CDD:238532
PAN_1 294..373 CDD:278453 81/389 (21%)
ZP 381..615 CDD:214579 56/256 (22%)
CG15020NP_647901.1 ZP 223..473 CDD:214579 57/264 (22%)
Zona_pellucida <371..472 CDD:278526 27/102 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.