DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment neo and pot

DIOPT Version :9

Sequence 1:NP_651733.1 Gene:neo / 43523 FlyBaseID:FBgn0039704 Length:744 Species:Drosophila melanogaster
Sequence 2:NP_001245635.1 Gene:pot / 32154 FlyBaseID:FBgn0250871 Length:963 Species:Drosophila melanogaster


Alignment Length:431 Identity:78/431 - (18%)
Similarity:144/431 - (33%) Gaps:110/431 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   259 LSELDRLTLAGSQAFQVN-----DGSDYLENHCVDEPNKLCEFKRLPGRILKTVDSVYQEVSSID 318
            |:.|..:.|||..|.|.|     |..:|..|...:|               .|:|.   :|:.:|
  Fly    18 LAALLLICLAGQTAAQSNYVQHGDSGNYTTNGLPEE---------------ATLDG---KVTKLD 64

  Fly   319 ECRELCLNSPYRCHSYDYNDTGDMVCRLSHHSRATLADVQEPFLEVPEASTYELTSCYNVTIECG 383
            :...|.                                    ||...:|:           :.|.
  Fly    65 DISPLI------------------------------------FLNRTKAA-----------LNCA 82

  Fly   384 GGDMLARIRTSKLFNGKVYAKGSPKS-CSVDVKSALDFELRMNYHDLECNVRQSTAGRYVNDIII 447
            .|.|...::.:..|:|.:.|.....| |.|..|.||.:.|.:....  |...|:....:.|:||:
  Fly    83 AGSMQVDLKFNDPFHGIIQADYDRSSACRVSGKGALSYRLELPLKG--CGTIQNPTRVFTNNIIV 145

  Fly   448 QHHDMIVTSSDLGLALACQYDLTNKSVSNGVDLDVRGDIMPALSEEVIVESPNVIMRITSRDGSD 512
            :.|..:....|..:.:.|:|.....|:...:...:...|..:...:..::|..::|.|.:     
  Fly   146 RFHANLEMDGDEIITIVCRYPPPVPSLPPALPAPILNPIATSSVLQPPLKSIQILMIICA----- 205

  Fly   513 MMRSAEVGDPLALKFEIVDEQSPYEIFIRELVAMDGVDNSEITLIDSNG-----------CPTDH 566
            :|....:...||:.:..:..:|   |.:...:.|.....||||.:..:.           .|..|
  Fly   206 IMFLTLLLLGLAVSYYCLRSRS---IPVVRRLPMSMGSGSEITKLSGSSVGNISAFEGVKIPRAH 267

  Fly   567 FIMGPIYKGSVS-GKMLLSNFDAFKFPSSEVVQFRALVTPCMPSCEPVQCEQEDTSGEFRSLLSY 630
            ..:..:|..|.| |.::.|:     :||....:...:.|..:|.......|......|..|:.| 
  Fly   268 AALQAVYSSSGSEGALIPSD-----YPSESHSEIEEIDTRSLPFSSAGSFENRAFVHETSSIYS- 326

  Fly   631 GRKRRSLNTTDDHPRPRRDIDTSKKSAPSDMLLVQSIQITD 671
                       ||..|.:::.::.....:..:...||.|.:
  Fly   327 -----------DHYAPAQEMPSANAVMTTTSVTRHSIPIQE 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
neoNP_651733.1 PAN_1 120..197 CDD:278453
PAN_AP_HGF 211..285 CDD:238532 10/30 (33%)
PAN_1 294..373 CDD:278453 8/78 (10%)
ZP 381..615 CDD:214579 48/246 (20%)
potNP_001245635.1 ZP 81..>201 CDD:214579 25/121 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.