DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment neo and cyr

DIOPT Version :9

Sequence 1:NP_651733.1 Gene:neo / 43523 FlyBaseID:FBgn0039704 Length:744 Species:Drosophila melanogaster
Sequence 2:NP_001285004.1 Gene:cyr / 31733 FlyBaseID:FBgn0030001 Length:513 Species:Drosophila melanogaster


Alignment Length:449 Identity:100/449 - (22%)
Similarity:154/449 - (34%) Gaps:124/449 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   359 EPFLEVPEASTYELTSCYNVT-------IECGGGDMLARIRTSKLFNGKVYAKGSPKSCSVDVKS 416
            |.|:.....:|...|:....|       :.|....:...:..|:.|.|.:|||..|..|....|.
  Fly    45 ESFINDTTTTTTTTTTTTTKTMQIQAMQVNCSRELLEMHLELSRPFRGLLYAKDFPLECRARGKD 109

  Fly   417 ALDFELRMNYHDLECNVR----QSTAGRYVNDIIIQHHDMIVTSSDLGLALACQYDLTNKSVSNG 477
            :....||:....  |.||    :..:..|...:::|....:..|:|:..::.||....    :.|
  Fly   110 STRLHLRIPTSG--CGVRAEPLEDGSLEYTVRVMLQKEQKLRQSTDILSSVRCQLPAN----AMG 168

  Fly   478 VDLDV--------RGDIMPALSEEVIV------ESPNVIMRITSR-------DGSDMMRSAEVGD 521
            :.|.|        |...|.||:....|      .|.|...|.|.|       .|.:...|.|||.
  Fly   169 MPLPVLRQEKGHDRNARMRALAAAAAVPALGATSSINQQQRETPRVRIWLELGGPNGTGSVEVGV 233

  Fly   522 PLALKFEIVDEQSPYEIFIR--ELVAMDGVDNSEITLIDSNGCPTDHFIMGPI------------ 572
            ...|....:   .|..|.:|  :..|:||:..|...|:|:.|||.|..:|..:            
  Fly   234 ATTLTVRAI---VPGNIGVRVVDCAALDGLGESTQQLLDARGCPIDEQVMPALHTQHRPAEEGWS 295

  Fly   573 --YKGSVSGKMLLSNFDAFKFPSSEVVQFRALVTPCMPSCEPVQC-----------EQEDTSGE- 623
              ::..:..:...:.|.|||||..|.:.....|..|...|..:.|           ||.....| 
  Fly   296 KQHEEDLVERTFAATFPAFKFPDRERLHVSCGVQLCKGKCPTLNCRLKTPPPALSAEQHLARIEV 360

  Fly   624 FRSL-----------LSYGRKRRSLNTTDDHPRPRRDIDTSKKSAPSDMLLVQSIQITDKFGFKQ 677
            |.||           |.|.| |.:::..|..|..|..:      .|.:..|..||          
  Fly   361 FNSLAVTAPQIEVDRLRYDR-RHNMSGEDYAPHVRGQV------MPGEGTLCLSI---------- 408

  Fly   678 DKQESGDFYDGNETTFTANEEGHGFCVNAIGLITAATIFLLTQLAVIAIWTYCYQRRQK 736
                              ::....|||  :||     |||:.  .|:||::....||::
  Fly   409 ------------------SKLAISFCV--LGL-----IFLVA--VVVAIFSLIRSRRRE 440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
neoNP_651733.1 PAN_1 120..197 CDD:278453
PAN_AP_HGF 211..285 CDD:238532
PAN_1 294..373 CDD:278453 3/13 (23%)
ZP 381..615 CDD:214579 64/274 (23%)
cyrNP_001285004.1 ZP 82..344 CDD:214579 64/270 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.