DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment neo and Matn1

DIOPT Version :9

Sequence 1:NP_651733.1 Gene:neo / 43523 FlyBaseID:FBgn0039704 Length:744 Species:Drosophila melanogaster
Sequence 2:XP_038965345.1 Gene:Matn1 / 297894 RGDID:1359410 Length:523 Species:Rattus norvegicus


Alignment Length:519 Identity:91/519 - (17%)
Similarity:165/519 - (31%) Gaps:187/519 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 GLCVLFSAHADQLPGALTKSQFP------------VFTIYAQKS------------------CLA 199
            |||.|......|:||:|..:..|            ||.:.:.:|                  .|.
  Rat    30 GLCSLMLLLLLQVPGSLGLASQPRGHLCRTRPTDLVFVVDSSRSVRPVEFEKVKVFLSQVIKSLD 94

  Fly   200 VKP-CSRAWYVDRVQNYKLKTEVKRTVSVASRRECFE------------LCLGENDFTCRSANYD 251
            |.| .:|...|:.....|.:..::...|.||..:...            |.|   .|....|..|
  Rat    95 VGPNATRVGLVNYASTVKPEFPLRAHTSKASLLQAVHRIQPLSTGTMTGLAL---QFAITKALSD 156

  Fly   252 RTSGACELSELDRLTL--------------------AGSQAFQVNDGS----------------- 279
            ...|....|::.::.:                    :|.:.|.:..|.                 
  Rat   157 AEGGRSRSSDISKVVIVVTDGRPQDSVRDVSERARASGIELFAIGVGRVDKATLRQIASEPQDEH 221

  Fly   280 -DYLENHCVDEPNKLCEFKRLPGRILKTVDSVYQEVSSIDE--------CRELCLNSP--YRC-- 331
             ||:|::                .:::.:...:||...:.:        |.::|::||  |.|  
  Rat   222 VDYVESY----------------NVIEKLAKKFQEAFCVSDLCATGDHYCEQVCVSSPGSYTCAC 270

  Fly   332 -HSYDYNDTGDM--VCRLSHHSRAT----LAD----VQEPFLEVPEASTYELTSCYNVTIECGGG 385
             ..:..|..|..  |||...:..||    |.|    |:....|:.:....::....:|:      
  Rat   271 HEGFTLNSDGKTCNVCRGGGNGSATDLVFLIDGSKSVRPENFELVKKFINQIVDTLDVS------ 329

  Fly   386 DMLARI----RTSKL--------FNGKVYAKGSPKSCSVDVK-----SALDFELRMNYHDLECNV 433
            |.||::    .:|.:        |:.|...|.:.::.|...|     :||.: |..|...:....
  Rat   330 DRLAQVGLVQYSSSIRQEFPLGRFHTKKDIKAAVRNMSYMEKGTMTGAALKY-LIDNSFTVSSGA 393

  Fly   434 RQS--------TAGR---YVNDIIIQHHDMIVTSSDLGLALACQYDLTNKSVSNGVDLDVRGDIM 487
            |..        |.||   |:||...:       :.|||      :.:....|.|.|:.::|....
  Rat   394 RPGAQKVGIVFTDGRSQDYINDAARK-------AKDLG------FKMFAVGVGNAVEEELREIAS 445

  Fly   488 PALSEEVIVESPNVIMRITSRDGSDMMRSAEVGDPLALKFEIVDEQSP--YEIFIRELVAMDGV 549
            ..:::.....             :|.....::|..|..|. .|:|:.|  .|..:|....::|:
  Rat   446 EPVADHYFYT-------------ADFKTINQIGKKLQKKI-CVEEEDPCACESIVRFEAKVEGL 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
neoNP_651733.1 PAN_1 120..197 CDD:278453 12/61 (20%)
PAN_AP_HGF 211..285 CDD:238532 17/123 (14%)
PAN_1 294..373 CDD:278453 19/101 (19%)
ZP 381..615 CDD:214579 37/199 (19%)
Matn1XP_038965345.1 vWA_Matrilin 60..282 CDD:238752 35/240 (15%)
vWFA 293..497 CDD:412136 44/237 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X161
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.