DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment neo and cutl-19

DIOPT Version :9

Sequence 1:NP_651733.1 Gene:neo / 43523 FlyBaseID:FBgn0039704 Length:744 Species:Drosophila melanogaster
Sequence 2:NP_871693.1 Gene:cutl-19 / 191090 WormBaseID:WBGene00022533 Length:237 Species:Caenorhabditis elegans


Alignment Length:204 Identity:36/204 - (17%)
Similarity:87/204 - (42%) Gaps:34/204 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   463 LACQY-DLTNKSVSNGVDLDVRGDIMPALSEEVIVESPNVIMRIT-SRDGSDMMRSA----EVGD 521
            :.|:| :|.|:.:  ||.::|...|..  :|..|..:.:...|:| .:.|.|....:    ::.|
 Worm    18 IKCEYSELMNQKI--GVRVEVLNMIYE--NETTITSTGHPRCRLTLHKSGWDRDTCSSPQFKLND 78

  Fly   522 PLA----LKFEIVDEQSPYEIFIRELVAMDGVDNSEITLIDSNGCPTDHFIM-GPIY----KGSV 577
            .|:    :.::.|.:.:.|.:.:..  ...|..|..:.::..:||..:..|: .|:|    :.:.
 Worm    79 TLSWSTRVCYKWVCDTTKYAMRVES--CWIGSPNMSVYILRDDGCTIEKAILTSPVYTSFNRAAA 141

  Fly   578 SGKMLLSNFDAFKFPSSEVVQFRALVTPCMPSCE----PVQCEQEDTSGEFRSLLSYGRKRRSL- 637
            .|.|.:...:.........::...|   |.|.|:    |..| .::.:.::.::.:...:.::| 
 Worm   142 IGWMAVRQKNMKYMHVGCTIRLCHL---CDPKCQTITPPRTC-NDNRADDYEAMWNSSSRVKNLC 202

  Fly   638 ----NTTDD 642
                :||::
 Worm   203 FPEPSTTEN 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
neoNP_651733.1 PAN_1 120..197 CDD:278453
PAN_AP_HGF 211..285 CDD:238532
PAN_1 294..373 CDD:278453
ZP 381..615 CDD:214579 32/170 (19%)
cutl-19NP_871693.1 ZP <17..171 CDD:214579 30/161 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.