DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment neo and cutl-1

DIOPT Version :9

Sequence 1:NP_651733.1 Gene:neo / 43523 FlyBaseID:FBgn0039704 Length:744 Species:Drosophila melanogaster
Sequence 2:NP_506321.3 Gene:cutl-1 / 186168 WormBaseID:WBGene00009979 Length:399 Species:Caenorhabditis elegans


Alignment Length:422 Identity:92/422 - (21%)
Similarity:165/422 - (39%) Gaps:107/422 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   303 ILKTVDSVYQEVSSIDECRELCLNSPYRCHSYDYNDTGDMVCRLSHHSRATLADVQEPFLEVPEA 367
            |.:|::..:.:...|.|      :|.|.||..|.:    :|.:|   ..||||....|.    :.
 Worm     6 IRRTLEDYFPKGFLISE------SSKYDCHLEDMH----LVLQL---LLATLAVNPVPI----QN 53

  Fly   368 STYELTSCYNVTIECGGGDMLARIRTSKLFNGKVYAK--GSPKSCSV----DVKSALDFELRMNY 426
            |.|.     :|.:||....:..:|:|.|.|.|.::.|  .|.:.|:.    .:.:.|:.|:.:  
 Worm    54 SLYG-----DVQVECDSRTISVQIKTEKPFVGVIFVKDFASEEVCTSRGTGRLSAFLEIEIGL-- 111

  Fly   427 HDLECN-VRQSTAGRYVN--------DIIIQHHDMIVTSSDLGLALACQYDLTNKSVSNGVDLDV 482
                |. :||    |.:|        .|.|..|...:|..|....|.|.|..:..:|:|.:.:|.
 Worm   112 ----CGALRQ----RVLNPKGLAVRTTITISFHPYFITKVDRTYNLLCLYRESQVTVANNISVDE 168

  Fly   483 RGDIMPALSEEVIVESPNVIMRITSRDGSDMMRSAEVGDPLALKFEIV------------DEQSP 535
                :..:|..|.:..|....:|.|        ....|:|  ::|.::            |::..
 Worm   169 ----ISTISYNVNLTMPTCTYQILS--------GGPFGEP--VEFGLIGQQVYHQWKCDNDKEDS 219

  Fly   536 YEIFIRELVAMDGVDNSEITLIDSNGCPTDHFIMGPI-YKGSVSGKMLLSNFDA--FKFPSSEVV 597
            :.:.:......||...:.. |||||||..|.|::..: |.|:     ||:..:|  :||...:.:
 Worm   220 FCMVVHTCSVDDGRGETSF-LIDSNGCSIDKFLLSNLEYPGN-----LLAGQEAHVYKFADRDAL 278

  Fly   598 QFRALVT--------PCM-PSCEPVQCEQEDTSG------EFRSLLSYG-RKRRSLNTTDDHPRP 646
            .|:..::        .|: |.||.|:.......|      ..::.:|:. |.:||..:.|:....
 Worm   279 FFQCQISITVKEPDQECVRPICEDVEGGGAPVVGPPPYGFSQKTQVSFNQRAKRSETSLDEQITD 343

  Fly   647 RR---------DIDTSKKSAPSDMLLVQSIQI 669
            .|         ||.|:........:|:.::.|
 Worm   344 VRTRFSVSYHFDIQTNSIEIIESCVLLSTMSI 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
neoNP_651733.1 PAN_1 120..197 CDD:278453
PAN_AP_HGF 211..285 CDD:238532
PAN_1 294..373 CDD:278453 18/69 (26%)
ZP 381..615 CDD:214579 61/272 (22%)
cutl-1NP_506321.3 ZP 62..300 CDD:214579 58/267 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X161
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.