Sequence 1: | NP_651733.1 | Gene: | neo / 43523 | FlyBaseID: | FBgn0039704 | Length: | 744 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_497718.2 | Gene: | C34C12.7 / 183201 | WormBaseID: | WBGene00007926 | Length: | 284 | Species: | Caenorhabditis elegans |
Alignment Length: | 234 | Identity: | 48/234 - (20%) |
---|---|---|---|
Similarity: | 85/234 - (36%) | Gaps: | 65/234 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 213 QNYKLKTEVKRTVSVASRRECFELCLGEN--DFTCRSANYDRTSGACELSELDRLTLAGSQAFQV 275
Fly 276 ND--GS---DYLENHCVDEPNK------------------LCEFKRLPGRILKTV--------DS 309
Fly 310 VYQEVSSIDECRELCLNSPYRCHSYD-YNDTGD--MVCRLSHHSRATLADVQEPF---------- 361
Fly 362 ------LEVPEASTYELTSCYNVTIECGGGDMLARIRTS 394 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
neo | NP_651733.1 | PAN_1 | 120..197 | CDD:278453 | |
PAN_AP_HGF | 211..285 | CDD:238532 | 19/78 (24%) | ||
PAN_1 | 294..373 | CDD:278453 | 20/105 (19%) | ||
ZP | 381..615 | CDD:214579 | 3/14 (21%) | ||
C34C12.7 | NP_497718.2 | PAN_AP_HGF | 36..107 | CDD:238532 | 16/65 (25%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0005301 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.000 |