DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment neo and C34C12.7

DIOPT Version :9

Sequence 1:NP_651733.1 Gene:neo / 43523 FlyBaseID:FBgn0039704 Length:744 Species:Drosophila melanogaster
Sequence 2:NP_497718.2 Gene:C34C12.7 / 183201 WormBaseID:WBGene00007926 Length:284 Species:Caenorhabditis elegans


Alignment Length:234 Identity:48/234 - (20%)
Similarity:85/234 - (36%) Gaps:65/234 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   213 QNYKLKTEVKRTVSVASRRECFELCLGEN--DFTCRSANYDRTSGACELSELDRLTLAGSQAFQV 275
            :||.:......|.||..:.||..:||..:  ...|.||.:......|.:|:.:::|  ....|..
 Worm    43 KNYWIVGHAFHTSSVQFKDECLRMCLTSSIRKAKCLSAMHVPNDDECVISDQNQVT--KPDLFIE 105

  Fly   276 ND--GS---DYLENHCVDEPNK------------------LCEFKRLPGRILKTV--------DS 309
            ||  |:   ::..|.|||.|:.                  :.||.:..|:..:.:        :|
 Worm   106 ND
TPGTFTVNFFRNICVDPPDAEGVDRFEARLQGYKGGEGIIEFAQAVGKNTQVMVVISGLKENS 170

  Fly   310 VYQEVSSIDECRELCLNSPYRCHSYD-YNDTGD--MVCRLSHHSRATLADVQEPF---------- 361
            :| |::.:.:.:|    ...:||... .|..|.  |:....|...|.     ||:          
 Worm   171 LY-EINFLPDTKE----KGGQCHRKSRVNGEGKTLMIVETDHTGMAV-----EPWKVIDFDGFEE 225

  Fly   362 ------LEVPEASTYELTSCYNVTIECGGGDMLARIRTS 394
                  :.|.|.||..:..|.::.:.....:. :..|||
 Worm   226 NVISKTIVVVEKSTQTIVDCGSIRLATASSNS-STTRTS 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
neoNP_651733.1 PAN_1 120..197 CDD:278453
PAN_AP_HGF 211..285 CDD:238532 19/78 (24%)
PAN_1 294..373 CDD:278453 20/105 (19%)
ZP 381..615 CDD:214579 3/14 (21%)
C34C12.7NP_497718.2 PAN_AP_HGF 36..107 CDD:238532 16/65 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005301
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.