DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment neo and C30H6.5

DIOPT Version :9

Sequence 1:NP_651733.1 Gene:neo / 43523 FlyBaseID:FBgn0039704 Length:744 Species:Drosophila melanogaster
Sequence 2:NP_001255948.1 Gene:C30H6.5 / 183068 WormBaseID:WBGene00007823 Length:530 Species:Caenorhabditis elegans


Alignment Length:379 Identity:76/379 - (20%)
Similarity:123/379 - (32%) Gaps:109/379 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LALMLYS---AATAKEHLRIRRQAAESVTAAAPNASKVMASEEIKDKTEWPGAKETSTEINRTER 73
            |.:.||.   |:|..|.:|:.....::.|.:||..:.::.:..:.......|. .|:..|:.|::
 Worm   151 LQIDLYENRCASTENETVRLAVFTEQTRTTSAPVRTSIVGNVIMAPVPNLNGT-TTNAPISTTQQ 214

  Fly    74 PVENVETRNSGFDLPAASDLSSSLGSEE-------------DSIYYDNAPVDCNPELVGFEIVTG 125
            .:            |..::|......::             .::|.|..........|.......
 Worm   215 AI------------PTTNELRRVHAVKQYPLDPKNGNVIFSKTVYADQPSPPLPQRFVDRRNRNA 267

  Fly   126 YVFSAPEKLMDSQPGTLMLTDCLDTCRKNKTCQSVNYETGLCVLFSAHADQLPGALTK-----SQ 185
            .:|.:|..|:||....:....           |.|..::.:            |:|||     |:
 Worm   268 KIFLSPRPLVDSTSSVVAAAQ-----------QQVQLQSDV------------GSLTKERRQRSE 309

  Fly   186 FPVF--TIYAQKSCLAVKPCSRAWYVDRVQNYKLKTEVKRTVSVASRRECFELCLGE-NDFTCRS 247
            .||.  .:.....|....|       :|:.:   |.|..| :...:...|...|... .:|.|.|
 Worm   310 RPVVLENLAVPAGCFIKTP-------NRILH---KFEESR-IGGVTLETCMRQCAQSLQNFYCAS 363

  Fly   248 ANYD-------RTSGACELSELDRLTLAGSQAFQVNDGSDYLENHCVDEPNKLCEFKRLPGRILK 305
            .||.       ...|...|:..|  ||.||:.|      ||.||.|  :|           |...
 Worm   364 INYSFGLKICILNGGNLHLNGGD--TLVGSREF------DYFENTC--QP-----------RSTT 407

  Fly   306 TVDSVYQEVSSIDECRELCLNSPYRCHSYDYNDTG--------DMVCRLSHHSR 351
            |.:|......:..||..|..||.|  :|:|....|        :..|..||..|
 Worm   408 TTESSIGGSGTKKECYRLYNNSIY--NSFDATIVGGLQDLESCESECSWSHIRR 459

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
neoNP_651733.1 PAN_1 120..197 CDD:278453 14/83 (17%)
PAN_AP_HGF 211..285 CDD:238532 22/81 (27%)
PAN_1 294..373 CDD:278453 16/66 (24%)
ZP 381..615 CDD:214579
C30H6.5NP_001255948.1 PAN_AP_HGF 80..159 CDD:238532 3/7 (43%)
PAN_AP_HGF 323..400 CDD:238532 24/95 (25%)
PAN_AP 422..488 CDD:214680 12/40 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47327
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.