DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment neo and ram-5

DIOPT Version :9

Sequence 1:NP_651733.1 Gene:neo / 43523 FlyBaseID:FBgn0039704 Length:744 Species:Drosophila melanogaster
Sequence 2:NP_510422.2 Gene:ram-5 / 181550 WormBaseID:WBGene00004301 Length:711 Species:Caenorhabditis elegans


Alignment Length:359 Identity:76/359 - (21%)
Similarity:134/359 - (37%) Gaps:82/359 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   391 IRTSKLFNGKVYAKGSPK-SCS-----VDVKSALDFELRMNY----------HDLECNVRQSTAG 439
            :.||..|: ..:..|.|: :||     |...:.:.|:.|::.          ||...|::::.. 
 Worm    18 LATSTDFD-NAHVMGVPQVTCSAKLITVSFNTNIPFQGRISVFDKLFIPACNHDYSTNIQKNAT- 80

  Fly   440 RYVNDII--------------------IQHHDMIVTSSDLGLALACQYDLTNKSVSNGVDLDVRG 484
             :..||:                    |..|.:::|:||....:.|              ||  .
 Worm    81 -FQMDILKCANPMFLKNGSRLLRAYVEIGFHPLVMTNSDRTFLVEC--------------LD--N 128

  Fly   485 DIMPALSEEVIVESPNVIMRITSRDGSDMMRSAEVGDPLALKFEI-VDEQSPYEIFIRELVAMDG 548
            .|||.::..........::|:.|...|  |...:|||.:..::.. :...:..:.|:....|:. 
 Worm   129 TIMPIVNRAQSFADCTHLVRMASEWSS--MSEFQVGDAIVHEWSCKLPNPAKTQTFLTNCNALS- 190

  Fly   549 VDNSEIT-LIDSNGCPTDHFIMGPI-YKGSVSGKMLLSNFDAFKFPSSE------VVQFRALVTP 605
             .|.:|. |||.|||..|..:||.| |...|  ..|.:....|||.:.:      .::|....:|
 Worm   191 -QNGQIIHLIDENGCVIDSELMGDIVYSDHV--PKLYARARIFKFLTDDKYRIECTLEFCNNGSP 252

  Fly   606 CMPSCEPVQC---EQEDTSGEFRSLLSYGRKRRSLNTTDDHPRPRRDIDTSKKSAPSDMLLVQSI 667
            |.....|.:|   ::|.||...::.|    ::..:.|....|....|   |:....|..|.::..
 Worm   253 CKDRVFPPKCAFTKEEITSRSTKNQL----EQSGMTTMPGIPSSAYD---SRLKISSAWLTIKLN 310

  Fly   668 QITDKFGFKQDKQESGDFYDGN-ETTFTANEEGH 700
            |.|:..|. ..:.....|.|.. ..|.:.|:..|
 Worm   311 QYTETKGL-HPRYHLKTFLDPTLHETISPNDADH 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
neoNP_651733.1 PAN_1 120..197 CDD:278453
PAN_AP_HGF 211..285 CDD:238532
PAN_1 294..373 CDD:278453
ZP 381..615 CDD:214579 57/268 (21%)
ram-5NP_510422.2 Zona_pellucida 36..264 CDD:391783 53/251 (21%)
PRK13042 522..>590 CDD:183854
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.