DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment neo and dyf-7

DIOPT Version :9

Sequence 1:NP_651733.1 Gene:neo / 43523 FlyBaseID:FBgn0039704 Length:744 Species:Drosophila melanogaster
Sequence 2:NP_001379066.1 Gene:dyf-7 / 181183 WormBaseID:WBGene00001123 Length:446 Species:Caenorhabditis elegans


Alignment Length:364 Identity:76/364 - (20%)
Similarity:132/364 - (36%) Gaps:78/364 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   346 LSHHSRATLADVQEPFLEVPEASTYELTSCYNVTIECGGGDMLARIRTSKLFNGKVYAKG----S 406
            |.|.::|:..|   .|:|:.:.    :...:.|.:.....:::..|...| ....||..|    .
 Worm    18 LIHQNKASEKD---RFVELVDC----IADSFTVVLNKSDPEVMRMISNPK-SQPVVYVYGHKTRH 74

  Fly   407 PKSCSV-DVKSALDFELRMNYHDLECNVRQS--TAGRYVNDIIIQHHDMIVTSSDLGLA------ 462
            |...|: |.|...:|.|.:.|.. ||:|..:  ...||....::     :..::||...      
 Worm    75 PCGTSMKDEKGLTNFNLTIPYGS-ECDVTLTDLPKHRYAETTVV-----LEDNADLSFGKTTRLN 133

  Fly   463 -LACQYDLTNKS-----VSNGVDLDVRGDIMPALSEEVIVES-----PNVIMRITSRDGSDMMRS 516
             :.|.|....|:     ||||              .|||..:     |.|.|...|.|....:::
 Worm   134 HVFCLYTRNVKTIRFSDVSNG--------------HEVIASTGGKPKPKVEMLFRSTDSGKTLQA 184

  Fly   517 AEVGDPLALKFEIVDEQ-----SPYEIFIRELVAMDGVDNSEITLIDSNGCPTD--HFIMGPIYK 574
            |...:.:.....:..:.     ||.|....:...:...|..:||.: ..|||.:  :.|:.|:  
 Worm   185 ARENEFVEFFIALSPDSAYHGISPKECTFSDREDISAPDAKKITFV-QGGCPVNGMNDIIDPL-- 246

  Fly   575 GSVSGKMLLSNFDAFKFPSSEVVQFRALVTPCM--PSCEPVQCEQEDTSGEFRSLLSYGRKRRSL 637
            .:|:.::..|.|..|:|.:...|.....|..|:  ..|.....::...|......|.:..||   
 Worm   247 ANVNDQIYFSKFRTFRFGNQSTVFVHCQVQVCLKKDECSKTCYKKVSDSNLTAERLRFRHKR--- 308

  Fly   638 NTTDDHPRPRRDIDTSKKSAPSD----MLLVQSIQITDK 672
            :.||...|..|       |||:|    :.|..|:.:..:
 Worm   309 SITDLERRTTR-------SAPTDDNGSLDLTNSLTVVSR 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
neoNP_651733.1 PAN_1 120..197 CDD:278453
PAN_AP_HGF 211..285 CDD:238532
PAN_1 294..373 CDD:278453 6/26 (23%)
ZP 381..615 CDD:214579 55/266 (21%)
dyf-7NP_001379066.1 Zona_pellucida 36..288 CDD:421542 56/279 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47327
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.