DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment neo and ZC449.1

DIOPT Version :9

Sequence 1:NP_651733.1 Gene:neo / 43523 FlyBaseID:FBgn0039704 Length:744 Species:Drosophila melanogaster
Sequence 2:NP_508855.1 Gene:ZC449.1 / 180775 WormBaseID:WBGene00022611 Length:454 Species:Caenorhabditis elegans


Alignment Length:321 Identity:88/321 - (27%)
Similarity:125/321 - (38%) Gaps:64/321 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 AKETSTEINRTERPVENVETRNSGFD-LPAASDLSSSLGSEEDSIYYDNAPVDCNPELVGFEIVT 124
            ||..|:.:.|.|...|.:.::..|.: |...|...:..|.|.|..  :|.|:.|... .|:.:|.
 Worm   161 AKAMSSPMVRMEDMDEVLRSKLRGEESLVPMSQKDTEEGKELDKT--ENGPLKCKTS-SGYYVVV 222

  Fly   125 GYVFSAPEKLMDSQP-GTLMLTDCLDTCRKNK-------TCQSVNY--ETGLCVLFSAHADQLP- 178
            |.....|....|.|. ..:...||...|.:||       .|:|:||  ....|.|:...|:  | 
 Worm   223 GNEIVLPISGGDVQVYNEVEQGDCAKYCSENKGPDGSTINCRSLNYFPVEKKCELYGILAE--PH 285

  Fly   179 --GALTKSQFPVFTIYAQKSCLAVKP--CSR-AWYVDRVQNYKLKTEVKR----TVSVASRRECF 234
              |.|.:::   ..|||:|.||...|  |.. ..::..||    ||..||    |.:.:|..:|.
 Worm   286 GSGKLLENE---KVIYAEKFCLPESPFVCQNDEIFILHVQ----KTLSKRRRITTKAASSITDCL 343

  Fly   235 ELCLGENDFTCRSANYDRTSGACELSELDRLTLAGSQAFQVNDGSDYLENHC---------VDEP 290
            ..||.::|  |||:.|...|..|||..:|..|  |..|...:..:..:||.|         .|.|
 Worm   344 RKCLEQDD--CRSSVYISNSKKCELHNVDVST--GDYARDSDRETVLIENGCRRKGVTPKRKDSP 404

  Fly   291 NKLCEFKRLPGRILKTVDSVYQEVSSID----ECRELCLNSPYRCHSYDYNDTGDM---VC 344
            :.        ..||.|..|..:..|..:    ||.........|..:   ||.|||   ||
 Worm   405 SL--------SSILDTSSSESESSSPSNGGWSECDYKINGETVRVRT---NDDGDMETEVC 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
neoNP_651733.1 PAN_1 120..197 CDD:278453 24/89 (27%)
PAN_AP_HGF 211..285 CDD:238532 25/77 (32%)
PAN_1 294..373 CDD:278453 15/58 (26%)
ZP 381..615 CDD:214579
ZC449.1NP_508855.1 PAN_AP 21..105 CDD:214680
PAN_1 230..303 CDD:278453 21/77 (27%)
PAN_1 317..391 CDD:278453 26/81 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47327
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.