DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment neo and ZC449.2

DIOPT Version :9

Sequence 1:NP_651733.1 Gene:neo / 43523 FlyBaseID:FBgn0039704 Length:744 Species:Drosophila melanogaster
Sequence 2:NP_508854.2 Gene:ZC449.2 / 180774 WormBaseID:WBGene00022612 Length:453 Species:Caenorhabditis elegans


Alignment Length:252 Identity:56/252 - (22%)
Similarity:93/252 - (36%) Gaps:72/252 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 ELVGFEIVTGYVFSAPEKLMDSQPGTLMLTDCLDTCRKNKT-------CQSVNYE--TGLCVLFS 171
            |.:.:.:|.|...|.  |::..:...:..:.||..|.:|..       |.|:|||  ..:|.:: 
 Worm   222 ETLSYFLVYGSRLST--KMLPQRLNGVDQSSCLMYCSQNINAIGQNIPCYSLNYEPTNEICEMY- 283

  Fly   172 AHADQLPGALTKSQFPVFTI-------YAQKSCLAVKPCSRAWYVDRVQNYK--LKTEVKRTVSV 227
                   |..|:::....|:       :..|.|:..|....|..:..|..||  :|..:.|...:
 Worm   284 -------GEQTRNESDSATLAIDDEHNFGDKFCIKTKYHCDAETLYPVHLYKKLMKNIIARVPGL 341

  Fly   228 ASRRECFELCLGENDFTCRSANYDRTSGACEL-----SELDRLTLAGSQAFQVNDGSDYLENHCV 287
            ||:..|...|:...:  |::..|  .:|.|.|     ||.:.|.|.||....|      :||.|.
 Worm   342 ASKISCLSECIENRE--CKAVTY--KNGMCVLHSVSPSEDESLLLDGSGKTMV------IENGCH 396

  Fly   288 DEPN----------------------KLCEFKRLPGRILKTVDSVYQEVSSIDECRE 322
            ...|                      .||:: .:.||.::    |.|.  ..|:|.|
 Worm   397 VSSNTNKSVTKSKEDSEESESSWQEWSLCQY-GVKGRKMR----VRQR--ECDDCEE 446

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
neoNP_651733.1 PAN_1 120..197 CDD:278453 18/92 (20%)
PAN_AP_HGF 211..285 CDD:238532 22/80 (28%)
PAN_1 294..373 CDD:278453 8/29 (28%)
ZP 381..615 CDD:214579
ZC449.2NP_508854.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.