DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment neo and T26C5.2

DIOPT Version :9

Sequence 1:NP_651733.1 Gene:neo / 43523 FlyBaseID:FBgn0039704 Length:744 Species:Drosophila melanogaster
Sequence 2:NP_495968.3 Gene:T26C5.2 / 174465 WormBaseID:WBGene00012032 Length:595 Species:Caenorhabditis elegans


Alignment Length:269 Identity:62/269 - (23%)
Similarity:99/269 - (36%) Gaps:68/269 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 AKETSTEINRTERPVENVETRNSGFDLPAASDLSSSLGSEEDSIYYDNAPVDCNPELVGFEIVTG 125
            ||....|:|..|.....:||.....|:.......:|..:||.    :|..:|.|           
 Worm   354 AKSFLDEVNEEEENENIIETECQQDDVDVWIAFENSAQAEES----ENVDIDSN----------- 403

  Fly   126 YVFSAPEKLMDSQPGTLMLTDCLDTCRKNKTCQSVNY--ETGLCVLFSAHADQL-----PG---- 179
                .|.|           .:|...| |.|.|:|..|  :|..|.| |..:|.:     |.    
 Worm   404 ----VPNK-----------RECEKIC-KEKNCRSYTYFEKTHTCHL-STKSDGVTIKAPPSGDFT 451

  Fly   180 ALTKSQF---PVFTIYAQKSCLAVKPCSRAWYVDRVQNYKLKTEVKRTVSVASR-----RECFEL 236
            |.|.::|   ..|:::        ..||.  :| ..::|.::.|.....:...:     :.|.||
 Worm   452 ATTSTKFCYPRTFSVF--------DGCSN--FV-AFRDYSVRIEAVEEFNDLPKGYDGMQLCIEL 505

  Fly   237 CLGENDFTCRSANYDRTSGACELSELDRLTLAGSQAFQVNDGSDYLENHCVDEPNKLCEFKRLPG 301
            |:....|||||:.::..:|.|.|...|.:|...|..:.....:.|.||.|.:..|:      .||
 Worm   506 CVLSTKFTCRSSTFNPITGQCRLMTEDSMTSPDSFEYDEFQKALYFENGCTNAENE------TPG 564

  Fly   302 RILKTVDSV 310
            ...:.|:.|
 Worm   565 SSDRNVEIV 573

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
neoNP_651733.1 PAN_1 120..197 CDD:278453 19/90 (21%)
PAN_AP_HGF 211..285 CDD:238532 19/78 (24%)
PAN_1 294..373 CDD:278453 4/17 (24%)
ZP 381..615 CDD:214579
T26C5.2NP_495968.3 PAN_AP 22..>79 CDD:214680
PAN_1 385..459 CDD:278453 23/105 (22%)
PAN_AP_HGF <496..553 CDD:238532 16/56 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47327
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.