DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment neo and AgaP_AGAP003317

DIOPT Version :9

Sequence 1:NP_651733.1 Gene:neo / 43523 FlyBaseID:FBgn0039704 Length:744 Species:Drosophila melanogaster
Sequence 2:XP_319545.5 Gene:AgaP_AGAP003317 / 1279767 VectorBaseID:AGAP003317 Length:339 Species:Anopheles gambiae


Alignment Length:119 Identity:28/119 - (23%)
Similarity:49/119 - (41%) Gaps:8/119 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   525 LKFEIVDEQSPYEIFIRELVAMDGVDNSEITLIDSNGCPTDHFIMGPIYKGSVSGKMLLSN-FDA 588
            :|.|:.:....|.|.::...|.: ..|..:.|||..|||..:..| ..::.|..|....:. ...
Mosquito    74 IKAEVTNPNGTYGIRVKNCFAFN-KKNMSVALIDDRGCPLKNDTM-TRFRTSADGTSATAQIMSM 136

  Fly   589 FKFPSSEVVQFRALVTPCMPSCEPVQCEQEDTSGEFRSLLSYGRKRRSLNTTDD 642
            |||.....|.|:..|..|...|.  :.::...:|:..:.:   :..|:|...||
Mosquito   137 FKFSEGSEVHFQCDVVQCNGRCP--ELDEAICTGDANAFV---KSARALGQMDD 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
neoNP_651733.1 PAN_1 120..197 CDD:278453
PAN_AP_HGF 211..285 CDD:238532
PAN_1 294..373 CDD:278453
ZP 381..615 CDD:214579 23/90 (26%)
AgaP_AGAP003317XP_319545.5 Zona_pellucida <63..159 CDD:278526 22/86 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.