DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment neo and AgaP_AGAP005350

DIOPT Version :9

Sequence 1:NP_651733.1 Gene:neo / 43523 FlyBaseID:FBgn0039704 Length:744 Species:Drosophila melanogaster
Sequence 2:XP_315362.4 Gene:AgaP_AGAP005350 / 1276057 VectorBaseID:AGAP005350 Length:398 Species:Anopheles gambiae


Alignment Length:318 Identity:77/318 - (24%)
Similarity:132/318 - (41%) Gaps:73/318 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   404 KGSP-KSCSVDVKSALD-FELRM-NYHDLECNVRQSTAGRYVNDI----IIQHHDMIVTSSDLG- 460
            ||.| ..|...::..|. |||.: |.:|  |.|.     |.:|.|    :..|..::.|..|.| 
Mosquito    23 KGYPDPKCKPTIRENLAVFELSLTNIYD--CGVT-----RVINQITGKKVFYHRIIVETGPDTGK 80

  Fly   461 --LALACQYDLTNKSVSNGVDLDVRGDIMPA---------LSEEVIVESPNVIMRITSRDGSDMM 514
              :::.|.....:.:|::|:   |:.|::||         ::..:...:|...:.|..|.| |.:
Mosquito    81 EIVSVKCITTGPSYNVTHGI---VKRDVLPAGFQEPEDLEITTSITENAPEPSLGIAIRQG-DKL 141

  Fly   515 RSAEV----GDPLALKFEIVDEQSP-YEIFIRELVAMDGVDNSEITLIDSNGCPTDHFIMGPIYK 574
            .|.::    |..|.::..:.:..:| |.:.:..::..| ....|.|:| .|||..|.::....  
Mosquito   142 VSGDLNVSPGAHLQMEIFLDNRSAPIYGLGVNYMLVTD-TKYQEETII-FNGCSVDPYLFENF-- 202

  Fly   575 GSVSGKMLLSNFDAFKFPSSEVVQFRALVTPCMPSCEPVQCEQEDTSGEFRSLLSYGRKRRSLNT 639
            .:|.|.:|.:.|.|||||.|..||||..|..|:..|:.|.|....|        ::||::|.:: 
Mosquito   203 NTVDGDLLAAKFRAFKFPESTYVQFRGTVNVCVDRCKGVICSNGQT--------AFGRRKREIS- 258

  Fly   640 TDDHPRPRRDIDTSKKSAPSDMLLVQSIQITDKFGFKQDKQESGDFYDGNETTFTANE 697
                            :||:|...|..:.:|......         ||.|....|.:|
Mosquito   259 ----------------AAPADPNKVYEVTMTTFIKVN---------YDENADQNTVSE 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
neoNP_651733.1 PAN_1 120..197 CDD:278453
PAN_AP_HGF 211..285 CDD:238532
PAN_1 294..373 CDD:278453
ZP 381..615 CDD:214579 62/234 (26%)
AgaP_AGAP005350XP_315362.4 ZP 4..244 CDD:214579 62/235 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28JEZ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.