DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment neo and AgaP_AGAP003211

DIOPT Version :9

Sequence 1:NP_651733.1 Gene:neo / 43523 FlyBaseID:FBgn0039704 Length:744 Species:Drosophila melanogaster
Sequence 2:XP_312919.4 Gene:AgaP_AGAP003211 / 1273887 VectorBaseID:AGAP003211 Length:637 Species:Anopheles gambiae


Alignment Length:335 Identity:78/335 - (23%)
Similarity:138/335 - (41%) Gaps:57/335 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   365 PEASTYELTSCYNVTIECGGGDMLARIRTSKLFNGKVYAKG--SPKSCSVDVKS-----ALDFEL 422
            |.:::.:.....::.::|....|...|...:.|.|.:::||  |...| |.:|.     :..||:
Mosquito    85 PLSASNDSPQIKHLQVQCEKTHMRVNIEFDRPFYGMIFSKGFYSDPHC-VHLKPGTGHLSATFEI 148

  Fly   423 RMNYHDLECNVRQSTA--------GRYV-NDIIIQHHDMIVTSSDLGLALACQ-YDLTNKSVSNG 477
            .:|...:..:...:.|        |.|| |.||||:...:....|....|.|. ||...|:|:  
Mosquito   149 FLNSCGMSSSANHNAASFGGPTPSGSYVENTIIIQYDPYVQEVWDQARKLRCTWYDFYEKAVT-- 211

  Fly   478 VDLDVRGDIMPALSEEVIVESPNVIMRITSRDG---SDMMRSAEVGDPLALKFEIVDEQSPYEIF 539
             ....:.|::.|::...:.::....|:|....|   |::....::|..:.:...|.|:::.:::.
Mosquito   212 -FRPFQVDMLHAVTANFLGDNLQCWMQIQVGKGPWASEVSGIVKIGQTMTMVLAIKDDENKFDML 275

  Fly   540 IRELVAMDGVDNSEITLIDSNGCPTDHFIMGPIYK----GSVSGKMLLSNFDAFKFPSSEVVQFR 600
            :|..||.|| ..:.|.|:|.:||.....||....|    |..:..:..:.|.|||||.|..|.|:
Mosquito   276 VRNCVAHDG-KRAPIQLVDQHGCVVRPKIMSKFQKIKNFGPSASVVSFAYFQAFKFPDSMNVHFQ 339

  Fly   601 ALVTPCMPSCEPVQCEQED----------TSGEFRS------------LLSYGRKRRSLNTTDDH 643
            .::..|..:|...:|...|          .|||:.:            |..||....:      :
Mosquito   340 CVIQVCRYNCPEPKCAGGDYGLPALTGNGISGEYGAPGPLSGEYGPPHLSEYGVPPAA------Y 398

  Fly   644 PRPRRDIDTS 653
            |.||...|.|
Mosquito   399 PDPRHPSDAS 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
neoNP_651733.1 PAN_1 120..197 CDD:278453
PAN_AP_HGF 211..285 CDD:238532
PAN_1 294..373 CDD:278453 1/7 (14%)
ZP 381..615 CDD:214579 64/257 (25%)
AgaP_AGAP003211XP_312919.4 ZP 101..354 CDD:214579 64/257 (25%)
Zona_pellucida <247..346 CDD:278526 27/99 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X161
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.