DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment neo and matn3

DIOPT Version :9

Sequence 1:NP_651733.1 Gene:neo / 43523 FlyBaseID:FBgn0039704 Length:744 Species:Drosophila melanogaster
Sequence 2:XP_017949551.2 Gene:matn3 / 101731756 XenbaseID:XB-GENE-985172 Length:402 Species:Xenopus tropicalis


Alignment Length:259 Identity:47/259 - (18%)
Similarity:81/259 - (31%) Gaps:105/259 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   210 DRVQNYKLKTEVKRTVSVASRRECFELCLGENDFTCRSANYDRTSGACELSELDRLTLAGSQAFQ 274
            ||||:            ||:|              .|:.|.:..:...:.:::..|.|..|:  .
 Frog   208 DRVQD------------VAAR--------------ARAMNIEIYAVGVDRADMKSLRLMASE--P 244

  Fly   275 VNDGSDYLENHCVDEPNKLCEFKRLPGRILKTVDSVYQEVSSID-------ECRELCLN--SPYR 330
            ::|...|:|.:.|.|...| :|:              :.:..||       :|..:|::  ..|.
 Frog   245 LDDHVFYVETYGVIEKLTL-KFR--------------ESLCGIDACSMGRHDCEHICVSKKDSYF 294

  Fly   331 CHSYD-YNDTGDM-------VCRLSHHSRATLADVQEPFLEVPEASTYELTSCYNVTIECGGGDM 387
            |...| |....|.       :|.|..|                        .|.::.:...|.  
 Frog   295 CKCRDGYTLNPDKKTCSRIDICALGRH------------------------GCEHICVSSDGS-- 333

  Fly   388 LARIRTSKLFNGKVYAKGSPKSCSVDVKSALD------------FELRMNYH--DLECNVRQST 437
                .|.|..||.. .....|:||.:|:..:.            |:.::|.|  .|...:.|.|
 Frog   334 ----YTCKCRNGYT-LNPDKKTCSQEVRRVVQVEDPCKCEALVAFQRKVNTHIESLTSRLEQLT 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
neoNP_651733.1 PAN_1 120..197 CDD:278453
PAN_AP_HGF 211..285 CDD:238532 14/73 (19%)
PAN_1 294..373 CDD:278453 13/95 (14%)
ZP 381..615 CDD:214579 15/71 (21%)
matn3XP_017949551.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X161
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.