DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7829 and Prss36

DIOPT Version :9

Sequence 1:NP_651732.1 Gene:CG7829 / 43522 FlyBaseID:FBgn0039703 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_017167884.1 Gene:Prss36 / 77613 MGIID:1924863 Length:863 Species:Mus musculus


Alignment Length:250 Identity:81/250 - (32%)
Similarity:119/250 - (47%) Gaps:30/250 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 RPDP--RIVGGFPADIANIPYIVSIQLYGIHHCGGSIINNHTILTAGHCL--NGV--PHRLLKVK 81
            ||:|  |||||..|.....|:.||:...|.|.||||:|....:|:|.||.  ||.  |...|.|.
Mouse    41 RPEPSSRIVGGSDAHPGTWPWQVSLHQGGGHICGGSLIAPSWVLSAAHCFVTNGTLEPADELSVL 105

  Fly    82 VGGTSRYRKDGEL-----FSVADLQVHENFNPKTMDYDIGIIRLTKNLTLSRKVK--AIPINPER 139
            :|..|   :||.|     .|||.:.:.:|::...:..|:.::||.....|...|:  .:|.....
Mouse   106 LGVHS---QDGPLEGAHMRSVATILIPDNYSTVELGADLALLRLASPAKLGPSVRPVCLPRASHL 167

  Fly   140 VAEGTYATIAGWG--FKSMNGPPSDSLRYARVPIVNQTACRNLLGK--------TVTDRMLCAGY 194
            .|.||.....|||  .:::..|....|:...:.::.:.||:.|..:        .:...||||||
Mouse   168 FAHGTACWATGWGDVQEAVPLPLPWVLQEVELRLLGEAACQCLYSRPGPFNLTFQLLPGMLCAGY 232

  Fly   195 LKGGTDACQMDSGGPLSVREQ----LVGIVSWGVGCALADKPGVYSRLDALHPWL 245
            ..|..|.||.||||||...:.    |.||.|:|.||...::|||::.:.....|:
Mouse   233 PAGRRDTCQGDSGGPLVCEDGGRWFLAGITSFGFGCGRRNRPGVFTAVAPYESWI 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7829NP_651732.1 Tryp_SPc 27..244 CDD:214473 77/241 (32%)
Tryp_SPc 28..248 CDD:238113 77/242 (32%)
Prss36XP_017167884.1 Tryp_SPc 48..290 CDD:238113 77/242 (32%)
Tryp_SPc 331..532 CDD:389826
Tryp_SPc 607..789 CDD:389826
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167839459
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.