DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7829 and TPSAB1

DIOPT Version :9

Sequence 1:NP_651732.1 Gene:CG7829 / 43522 FlyBaseID:FBgn0039703 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_003285.2 Gene:TPSAB1 / 7177 HGNCID:12019 Length:275 Species:Homo sapiens


Alignment Length:246 Identity:80/246 - (32%)
Similarity:124/246 - (50%) Gaps:25/246 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 IVGGFPADIANIPYIVSIQLYG---IHHCGGSIINNHTILTAGHCLNGVPHRL--LKVKVGGTSR 87
            ||||..|..:..|:.||::::|   :|.||||:|:...:|||.||:......|  |:|::.....
Human    31 IVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHL 95

  Fly    88 YRKDGELFSVADLQVHENFNPKTMDYDIGIIRLTKNLTLSRKVKAIPINP--ERVAEGTYATIAG 150
            |.:| :|..|:.:.||..|....:..||.::.|.:.:.:|..|..:.:.|  |....|....:.|
Human    96 YYQD-QLLPVSRIIVHPQFYTAQIGADIALLELEEPVNVSSHVHTVTLPPASETFPPGMPCWVTG 159

  Fly   151 WGFKSMNG--PPSDSLRYARVPIVNQTAC--RNLLG-------KTVTDRMLCAGYLKGGTDACQM 204
            ||....:.  ||...|:..:|||:....|  :..||       :.|.|.|||||..:  .|:||.
Human   160 WGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTR--RDSCQG 222

  Fly   205 DSGGPLSVREQ----LVGIVSWGVGCALADKPGVYSRLDALHPWLDQVLNK 251
            ||||||..:..    ..|:||||.|||..::||:|:|:.....|:...:.|
Human   223 DSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPK 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7829NP_651732.1 Tryp_SPc 27..244 CDD:214473 78/237 (33%)
Tryp_SPc 28..248 CDD:238113 79/241 (33%)
TPSAB1NP_003285.2 Tryp_SPc 31..268 CDD:238113 79/239 (33%)
Tryp_SPc 31..267 CDD:214473 78/238 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.