DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7829 and Prss56

DIOPT Version :9

Sequence 1:NP_651732.1 Gene:CG7829 / 43522 FlyBaseID:FBgn0039703 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_006529921.1 Gene:Prss56 / 69453 MGIID:1916703 Length:605 Species:Mus musculus


Alignment Length:250 Identity:88/250 - (35%)
Similarity:126/250 - (50%) Gaps:32/250 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 SRPDPRIVGGFPADIANIPYIVSIQLYGIHHCGGSIINNHTILTAGHCLNGVPHRLLKVKVGGTS 86
            :|...|||||..|.....|::|.:||.|:..|||.::....:|||.||..|..:.||...:....
Mouse   104 TRAHGRIVGGSTAPSGAWPWLVRLQLGGLPLCGGVLVAASWVLTAAHCFAGASNELLWTVMLAEG 168

  Fly    87 RYRKDGELFSVADLQVHENFNPKTMDYDIGIIRLTKNLTLSRKVKAIPINPERVAE--------- 142
            ...:..|...|..:..|..|:|:|...|:.:::|.           .|::||..|.         
Mouse   169 PQGEQAEEVQVNRILPHPKFDPQTFHNDLALVQLW-----------TPVSPEGPARPICLPQGSR 222

  Fly   143 ----GTYATIAGWGFKSMNGPPSDSLRYARVPIVNQTACRNLLGKTV-TDRMLCAGYLKGGTDAC 202
                ||...|||||....:||.|:::|.||||:::...|:.:||..: ...|||||||.||.|:|
Mouse   223 EPPAGTPCAIAGWGALFEDGPESEAVREARVPLLSADTCQKVLGPGLRPSTMLCAGYLAGGIDSC 287

  Fly   203 QMDSGGPLSV-------REQLVGIVSWGVGCALADKPGVYSRLDALHPWLDQVLN 250
            |.||||||:.       ||.|.|:.|||.||....|||||:|:.....||.:.::
Mouse   288 QGDSGGPLTCSEPGPRPREVLFGVTSWGDGCGEPGKPGVYTRVTVFKDWLQEQMS 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7829NP_651732.1 Tryp_SPc 27..244 CDD:214473 85/237 (36%)
Tryp_SPc 28..248 CDD:238113 86/240 (36%)
Prss56XP_006529921.1 Tryp_SPc 109..336 CDD:214473 85/237 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.