DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7829 and TMPRSS3

DIOPT Version :10

Sequence 1:NP_651732.1 Gene:CG7829 / 43522 FlyBaseID:FBgn0039703 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_076927.1 Gene:TMPRSS3 / 64699 HGNCID:11877 Length:454 Species:Homo sapiens


Alignment Length:203 Identity:43/203 - (21%)
Similarity:76/203 - (37%) Gaps:64/203 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   492 EGISSSSKTQSLDEILPPDSLVS--INSLPVNE------EALSEATNSQLLADQVAQNGASERLQ 548
            :|::|.|..:  :.|:.||.|.|  ::.|..|:      |..|.::.:.|:.:.|        |.
Human    66 DGVTSQSSNK--ERIVFPDGLYSMKLSQLKKNDSGAYRAEIYSTSSQASLIQEYV--------LH 120

  Fly   549 VDDLISIEPVA-DRVETTNPTLTNPFLDDVFEANNNVITDDVKMLQRTETGDNRSSATESNGYGD 612
            |...:|...|. ||....|.|..         .|....||        :.|:|.:.:.::.|.||
Human   121 VYKHLSRPKVTIDRQSNKNGTCV---------INLTCSTD--------QDGENVTYSWKAVGQGD 168

  Fly   613 RKEIPIDRAQIATNGGDVPEVQGDSGEQDASVDAPDTLIPGSIAEREHLKWRNAKPIANNPYSPD 677
            .:          .:.|....:...|||:|.::..               ..||  |::|: :|..
Human   169 NQ----------FHDGATLSIAWRSGEKDQALTC---------------MARN--PVSNS-FSTP 205

  Fly   678 VLQRRLSE 685
            |..::|.|
Human   206 VFPQKLCE 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7829NP_651732.1 Tryp_SPc 27..244 CDD:214473
TMPRSS3NP_076927.1 LDLa 74..107 CDD:238060 8/34 (24%)
SRCR_2 112..210 CDD:464747 29/150 (19%)
Tryp_SPc 216..444 CDD:214473
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.