DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7829 and CG17239

DIOPT Version :9

Sequence 1:NP_651732.1 Gene:CG7829 / 43522 FlyBaseID:FBgn0039703 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001259920.1 Gene:CG17239 / 59224 FlyBaseID:FBgn0042186 Length:248 Species:Drosophila melanogaster


Alignment Length:222 Identity:86/222 - (38%)
Similarity:122/222 - (54%) Gaps:10/222 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 RIVGGFPADIANIPYIVSIQLYGIHHCGGSIINNHTILTAGHCLNGVPHRLLKVKVGGTSRYRKD 91
            |||||....|.::|:..||...|..|||.:|.:...::||.|||.......|.|:||.:..: ..
  Fly    23 RIVGGDLITILSVPWQASILRLGRFHCGAAIYSEDIVITAAHCLTDRETEFLSVRVGSSFTF-FG 86

  Fly    92 GELFSVADLQVHENFNPKTMDYDIGIIRLTKNLTLSRKVKAIPINPERVAEGTYATIAGW---GF 153
            |::..|:.:.:||.:: ::...||.::||...|.|...|..||:.....|.|:.||::||   ||
  Fly    87 GQVVRVSSVLLHEEYD-QSWSNDIAVMRLQSKLRLGSAVSVIPLADTPPASGSPATVSGWGAIGF 150

  Fly   154 KSMNGPPSDSLRYARVPIVNQTACRNLLGKTVTDRMLCAGYLKGGTDACQMDSGGPLSVREQLVG 218
            |. |.|.  |:..|.|.||:|..||...|:.:|..|:||.  ..|.|||..||||||....:|||
  Fly   151 KK-NYPM--SILSASVDIVDQDQCRRSYGRKITKDMICAA--APGKDACSGDSGGPLVSGNKLVG 210

  Fly   219 IVSWGVGCALADKPGVYSRLDALHPWL 245
            |||:|..||..:.||||:.:..|.||:
  Fly   211 IVSFGKECAHPEYPGVYANVAELKPWI 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7829NP_651732.1 Tryp_SPc 27..244 CDD:214473 84/219 (38%)
Tryp_SPc 28..248 CDD:238113 85/221 (38%)
CG17239NP_001259920.1 Tryp_SPc 23..237 CDD:214473 85/220 (39%)
Tryp_SPc 24..237 CDD:238113 84/219 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443399
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109274at50557
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.